KEGG   Conexibacter woesei: Cwoe_4939Help
Entry
Cwoe_4939         CDS       T01153                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K02182  carnitine-CoA ligase [EC:6.2.1.48]
Organism
cwo  Conexibacter woesei
Brite
Enzymes [BR:cwo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.48  carnitine---CoA ligase
     Cwoe_4939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADB53350
UniProt: D3FC55
Position
5266628..5268181
Genome map
AA seq 517 aa AA seqDB search
MVNERGRTVTATPPAAGGLGDLLRSQALSRGDAPLLRFVGETRSYREVDAQTERLAHVLL
NRSIGRGDRVALMLPNGLDYPTAWLALAKLGAIAVPINIGYRSADLAHVLRDSGAKLALT
TAELEPRIREVDGALPIETPERLAPELAAAPSTPVPVDGGSGDDLLNLQYTSGTTGFPKA
CMLSHAYWLNLVVRCRELADLGEDDVCIAAQPFTYMDPQWMAATMIGCGGALEILPRFSA
STFWRSVRDSGATFTYLIGTMPLLLLRQPEDPAERDHRLRLVSCSGIVPELHAEFERRWN
VPWREAYGMTETGLDLHVPIDDAASVGSGSVGRPALGKEARIVGAGDAPLPDGEAGELVV
RGGVMMQGYWNRPEETASTLRGGWLHTGDLAVRAPDGSYRLVGRLKDMVRRGGENVAAQE
VEAVIATHPAVATVAVIAVPDELLIEEVKAVVELRDGAVVTAPELHAFAAERLARFKVPR
FWAFAGDLPRTPSARVEKHKLDAGREDCWDATAETVR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaatgagagagggaggaccgtgacggcaacacccccagccgccggcggactgggc
gacctgctccgcagccaggcgctttcacgcggagatgcacccttgctgcgattcgtcggc
gagacgcgctcctaccgcgaggtcgacgcacagaccgagcggctcgcccacgtgctcctc
aatcgatcgatcgggcgtggcgaccgcgtcgcgctgatgctgccgaacggcctcgactac
ccgacggcgtggctcgctctggcgaagctcggcgcgatcgccgtgcccatcaacatcggc
taccgcagcgccgacctcgcgcacgtgctgcgcgactcgggcgccaagctcgcgctcacg
acggcggagctggagccgcggatccgcgaggtcgacggcgcgctcccgatcgagacgccg
gagcggctggcgcccgagctcgccgccgcaccctccacgccggtgccggtcgacggcggc
agcggcgacgacctgctcaacctccagtacacctcgggcacgaccggcttcccgaaggcg
tgcatgctcagccacgcctactggctgaacctcgtcgtccgctgccgcgagctggcggac
ctgggcgaggacgacgtctgcatcgccgcgcagccgttcacgtacatggacccgcaatgg
atggcggcgacgatgatcggctgcggcggcgcgctggagatcctgccgcgcttctcggcc
tcgaccttctggcgctcggtccgcgacagcggcgcgacgttcacgtacctgatcgggacg
atgccgctgctgctcctgcgccagcccgaggaccccgccgagcgcgaccaccgcctgcgg
ctcgtcagctgctcggggatcgtgccggagctgcacgccgagttcgagcgccgctggaac
gtgccgtggcgcgaggcgtacgggatgaccgagaccggcctcgacctgcacgtcccgatc
gacgacgccgcgagcgtcggcagcggctcggtcggccggccggcgctcggcaaggaggcg
cggatcgtcggcgccggcgacgcgccgctgcccgacggcgaggcgggcgagctggtcgtg
cgcggcggcgtgatgatgcaggggtactggaaccgccccgaggagaccgccagcacgctg
cgcggcggctggctgcacaccggcgacctcgcggtgcgcgcgccggacggctcctaccgg
ctcgtcgggcggttgaaggacatggtccgccgcggcggcgagaacgtcgccgcgcaggag
gtcgaagcggtgatcgcgacccatcccgccgtcgcgaccgtcgccgtgatcgccgtcccc
gacgagctgctgatcgaggaggtcaaggcggtcgtcgagctgcgcgacggcgccgtcgtg
accgcccccgagctgcacgcgttcgcggccgagcggctggcgagattcaaggtcccgcgc
ttctgggcgttcgccggcgacctgccgcgcaccccctccgcgcgcgtcgagaagcacaag
ctcgacgccggtcgcgaagactgctgggacgcgacggcggagacggttcgatga

DBGET integrated database retrieval system