KEGG   Conexibacter woesei: Cwoe_4942Help
Entry
Cwoe_4942         CDS       T01153                                 

Definition
(GenBank) ABC transporter related protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_16 AAA_21 AAA_30 AAA_25 AAA_23 AAA_29 SRP54 AAA_22 AAA_33
Motif
Other DBs
NCBI-ProteinID: ADB53353
UniProt: D3FC58
Position
5269838..5270857
Genome map
AA seq 339 aa AA seqDB search
MSAIELRALVKRYGAHTALGGERGIDLTVDDGELVAILGPSGAGKTTALTLVAGFEEATS
GAVVIGGRDVTRLPAHKRDVGVVFQSYALFPHLTVGENVAFPLRTRRVPRAERRERVARA
LATVGLPGTEERAPATLSGGQQQRIALARALVFEPRILLLDEPLAALDRRLRDQMQVELR
ALHRELGVTMLLVTHDQEEALTLSDRLVVLHDGAIAQEGPPAEVYRRPANRFVAEFLGAS
NLLEHDGGLLLVRPEDVRVSANGAADGSGGSGGSGAEDTGVRALVEDSVFLGSRVVCRLR
TEDGRVLLAERPAAEQVPVAGERVRASWDPERTALLTDD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatcgagctgcgcgcgctcgtcaagcgctacggcgcgcacacggcgctcggc
ggcgagcgcgggatcgacctgaccgtcgacgacggcgagctggtcgcgatcctcggcccc
agcggcgccggcaagacgacggcgctgacgctcgtcgccggcttcgaggaggcgacctcc
ggtgcggtcgtgatcggcgggcgcgacgtgacgcggctgccggcgcacaagcgcgacgtc
ggcgtcgtcttccagagctacgcgctgttcccgcacctgacggtcggcgagaacgtcgcc
ttcccgctgcgaacgcgccgcgtccctcgcgccgagcggcgcgagcgggtcgccagagcg
ctcgcgacggtcggcctgcccggcaccgaggagcgcgcccccgcgacgctgtccggcgga
cagcagcagcggatcgcgctcgcgcgggcgctcgtcttcgagccgcggatcctgctgctc
gacgagccgctggcggcgctcgaccggcgactgcgcgaccagatgcaggtcgagctgcgc
gcgctccaccgcgagctgggcgtgacgatgctgctcgtcacgcacgaccaggaggaggcg
ctgacgctgtcggaccggctcgtcgtgctgcacgacggggcgatcgcgcaggaggggccg
ccggcggaggtctaccgccgcccggcgaaccgcttcgtcgcggagttcctcggcgccagc
aacctgctcgaacacgacggcggcctgctgctggtgcggcccgaggacgtgcgcgtgagc
gcgaacggcgcggctgacgggagcggcgggagcggcgggagcggcgccgaggacacgggc
gtgcgggcgctcgtggaggacagcgtcttcctcggctcgcgcgtggtctgccgcctgcgg
accgaggacgggcgggtgctgctggcagagcgaccggcggcggagcaggtcccggtcgca
ggcgagcgcgtgcgcgcgagctgggacccggagcgcaccgcgctcctgaccgacgactga

DBGET integrated database retrieval system