KEGG   Conexibacter woesei: Cwoe_4943Help
Entry
Cwoe_4943         CDS       T01153                                 

Definition
(GenBank) extracellular solute-binding protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5270877..5271935
Genome map
AA seq 352 aa AA seqDB search
MRRRWCAAMAATTLLATALAGCGSSDDDGGTTTAGAKQSGGVELRVLEAGGASGEAMQKA
YIAPFEQATGNSVVRASPSEMGKLQAQVRTGKVTDSIVELDSIQAVAAGALGLTEPIDYA
AVRAAPMDPAARHENALCYQYYSTIPAWRAGARALPSVQQFFDVDGYPGKRSLPDYPTFA
LPLAAVADGVPLDRVFPLDVDRAFAALDRIKDDVDVWWSSGAQPAQLLRDGEVDYALAWS
GRIAAQDGIEHTYDGGLLDLGCLVVPRGAPHVEQANALLHEYSLPANQAELARLIPYSGP
AEGMARLVAPERAKLLPTGEGNRDVQFLQDPEWWAANYEDVLKRWEAWKLSR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaggagacggtggtgcgcggcgatggccgcgacgacgctgctcgcgacggcgctcgcc
ggctgcggcagcagcgatgacgacggcggcacgacgacggccggcgcgaagcagtccggc
ggcgtcgagctgcgcgtgctggaggccggcggcgcgtccggcgaggcgatgcagaaggcg
tacatcgcgccgttcgagcaggcgaccggcaacagcgtcgtgcgcgcgagcccgtcggag
atgggcaagctgcaggcgcaggtcagaaccggcaaggtgaccgactcgatcgtcgagctg
gactcgatccaggcggtcgcggccggcgcgctcgggctgaccgagccgatcgactacgcg
gccgtcagagcggcgccgatggacccggccgccagacacgagaacgcgctctgctaccag
tactactcgacgatcccggcgtggagagcgggcgccagagcgctcccctccgtgcagcag
ttcttcgacgtcgacggctacccgggcaagcgctcgctgcccgactacccgacattcgcg
ctgccgctcgcggccgtcgccgacggcgtcccgctcgacagggtcttcccgctcgacgtc
gaccgcgccttcgccgcgctcgacaggatcaaggacgacgtcgacgtctggtggtcctcc
ggcgcgcagccggcgcagctgctgcgcgacggcgaggtcgactacgcgctcgcatggtcg
ggccggatcgccgcccaggacgggatcgagcacacctacgacggcgggctgctcgacctc
ggctgcctcgtcgtgccgagaggcgcgccgcacgtcgagcaggcgaacgcgctgctgcac
gagtactcgctgccggccaaccaggccgagctggcgaggctgatcccgtactccggaccc
gccgaggggatggcgagactcgtcgcgccggagcgcgcgaagctgctgccgaccggcgag
ggcaaccgcgacgtccagttcctccaggacccggagtggtgggcggccaactacgaggac
gtcctcaagcgatgggaagcgtggaagctcagccgctga

DBGET integrated database retrieval system