KEGG   Conexibacter woesei: Cwoe_4956Help
Entry
Cwoe_4956         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB53367
UniProt: D3FC72
Position
complement(5285527..5286138)
Genome map
AA seq 203 aa AA seqDB search
MAIGFTRAFQHEDWVDNVDRVQAAGDNGFNQRFHGIESDLDTIGGVVDQISRTLDSLSAT
PAPLELRESITPIVTQVGAIGWDQQPGFAQKLTGQTSATGLIGVQLPHGARILRFRAIGR
NSGAGALRLELVRLSITNPAASPELIARVIGAADPYEQIPLAAAAFQRVDNDRFKYYINA
LLNGAGANDTVTIVGLQVVYATS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcggcttcacgcgcgccttccagcacgaggactgggtcgacaacgtcgaccgc
gtgcaggcggcgggcgacaacggcttcaaccagcggttccacgggatcgagtccgacctc
gacacgatcggcggcgtggtcgaccagatctccagaacgctcgactcgctgtcggcgacg
ccggcaccgctcgagctgcgcgaatcgataacgccgatcgtcacccaggtcggcgcgatc
ggctgggaccagcagccgggcttcgcgcagaagctgaccggccagacgtcggcgaccggt
ctgatcggcgtgcagctgccgcacggggcgagaatcctcagattccgcgcgataggccgc
aacagcggcgcgggcgcgctgcgcctggagctggtgcggctctcgatcacgaacccggcg
gcgtcgccggagctgatcgcgagagtgatcggggcggccgatccctacgagcagataccg
ctcgcggcggcggccttccagagagtcgacaacgacagattcaagtactacatcaacgcg
ttgctcaacggcgcgggcgccaacgacacggtcacgatcgtcggtctgcaggtcgtctac
gcgaccagctga

DBGET integrated database retrieval system