KEGG   Conexibacter woesei: Cwoe_4960Help
Entry
Cwoe_4960         CDS       T01153                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB53371
UniProt: D3FC76
Position
complement(5291907..5292245)
Genome map
AA seq 112 aa AA seqDB search
MPLVCNGSAVIRCSHSGTVTVIPGQQRLKAGGQAVLVESDLMRAAIAGCTNTDARAGQVP
CLRIVSVTAGLARRLKAGGEAVVLEDASGRTSSTPPGSFSISNAGQTRLRAS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgccactcgtctgcaacgggagcgcggtcatcagatgctcgcacagcgggaccgtgacg
gtgataccgggtcagcagagactgaaggccggtgggcaggctgtgctcgtcgagagcgac
ctgatgagagcggcgatcgccggctgcacgaacaccgacgcgagagccggccaggtgccg
tgtctgagaatcgtctccgtcaccgccggtctcgcgagaagactgaaggccggtggcgag
gcggtcgtgcttgaggacgcgagcggcagaaccagctcgacgccgccgggcagcttctcg
atctcgaacgccggccagacgagattgagagcgagctga

DBGET integrated database retrieval system