KEGG   Conexibacter woesei: Cwoe_4963Help
Entry
Cwoe_4963         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB53374
UniProt: D3FC79
Position
complement(5294262..5294759)
Genome map
AA seq 165 aa AA seqDB search
MAIGVNFPVLVGGLPLLNVQRMTLDEGYRVEKISGSRFSQLITPTTRTLTIDVVLTGRER
LILKKGLEALALTSRALASAAAPALALAGIPVISLFTILLDMQITDLRFENTIDPRDAVK
ATIRLAHVPRHMASEIVGESLDLALAAASAAIPTTPPPNPIPRAA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcggcgtgaacttccccgtcctcgtcggcggcctgccgctcctcaacgtgcag
agaatgacgttggacgagggctacagagtcgagaagatcagcggcagccgcttctcgcag
ctgatcaccccgacgacgcgcacgctgacgatcgacgtcgtgctgaccggccgcgagcgg
ctgatcctgaagaagggcctggaggcgctcgcgctcacctcgcgcgcgctcgcgagcgcg
gccgcgccggcgctggcgctcgccggcatcccggtcatatcgctgttcacgatcctgctc
gacatgcagatcacggacctcagattcgagaacacgatcgacccccgcgacgcggtcaag
gccaccatcagactcgcgcacgtgccgcgccacatggcgtcggagatcgtcggcgagtcg
ctcgacctcgcgctcgcggcggcctccgccgcgataccgacgacgcccccgccgaacccg
atcccccgcgcggcgtga

DBGET integrated database retrieval system