KEGG   Conexibacter woesei: Cwoe_4964Help
Entry
Cwoe_4964         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5294764..5294925)
Genome map
AA seq 53 aa AA seqDB search
MARVEVHVPLTLRLVGRPTEADWQRLEEALVRRFARAFGTDLQVASPPSREGS
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgtcgaggtccacgtcccgctcacgctgcgactcgtcggccgcccgacggag
gccgactggcagcggctggaggaggcgctcgtgcgccgcttcgcgcgcgccttcgggacc
gacctgcaggtggcgtcgccaccgtcccgcgaggggagctga

DBGET integrated database retrieval system