KEGG   Conexibacter woesei: Cwoe_4972Help
Entry
Cwoe_4972         CDS       T01153                                 

Definition
(GenBank) Capsule synthesis protein, CapA
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGA_cap
Motif
Other DBs
NCBI-ProteinID: ADB53383
UniProt: D3FC88
Position
5300677..5301846
Genome map
AA seq 389 aa AA seqDB search
MVAQPPPPPPAPAPPPLVLRAPRLVATGVAFELRGRGASAGERVRVQLRLDGRWRELAAA
RAGRDGRVTTRVAPRTPRPAYRLRIATRDGRLSDGVVVRTRDVTLAAVGDINLGDATAGA
IAAGGVNYPWTSVAPALRGADVAFGNLECAISTRGAPVQKQYTFRGSPAALRAMRDYAGF
DVLNLANNHVGDYGTAALLDTVEHVRAGGMEAVGAGGSLASAAAPRVVERLGLRIAFVGF
SNILPSEFFATPSRAGTQPATTAQIRASVAAARRRADVVIATFHWGVELDPVENGAEQAF
AATALAAGATAVIGGHPHVLQPIRMLDGGRRLVAYSLGNFVFASHRAATVRTGVLHLDLS
ARGVERTRFQHARIDGVKPLLTGRWTRVG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcccaaccccctcccccgccgccggctcccgctccgccaccgctcgtgctgcgc
gcaccgcggctggtcgccaccggcgtcgcgttcgagctgcgcgggcgcggggcgagcgcc
ggcgagcgcgtgcgggtgcagctgcggctcgacggccgctggcgcgagctggcggcggcg
cgcgccggcagggacggccgcgtcacgacgcgtgtcgcgccgcgcacgccgcggcccgcg
taccgcctgcggatcgcgacgcgcgacgggcgcctctcggacggcgtcgtcgtgcgcacg
cgcgacgtcacgctcgcggcggtcggcgacatcaacctcggcgacgcgacggccggggcg
atcgcggccggcggcgtcaactatccgtggacgagcgtcgcgccggcgctgcgcggcgcc
gacgtcgcgttcggcaacctcgagtgcgccatctcgacgcgcggcgcgccggtgcagaag
cagtacaccttccgcggcagcccggcggcactgcgggcgatgcgcgactacgccggcttc
gacgtgctcaacctcgccaacaaccacgtcggcgactacggcaccgcggcgctgctcgac
accgtcgagcacgtccgcgccggcggtatggaggcggtcggcgccggcggctcgctcgcc
tccgccgcggcgccgcgcgtcgtcgagcggctggggctgcggatcgccttcgtcggcttc
tcgaacatcctcccgagcgagttcttcgcgacgccgtcacgggccggcacgcagccggcg
acgacggcgcagatccgcgcctccgtcgccgccgccagacgccgcgccgacgtcgtgatc
gcgaccttccactggggcgtcgagctggacccggtcgagaacggcgccgagcaggcgttc
gccgcgaccgcgctggcggccggcgcgaccgccgtgatcggcggtcacccgcacgtgctg
cagccgatccgcatgctcgacggcggccgccgcctcgtcgcgtacagcctcggcaacttc
gtcttcgcctcccaccgcgcggcgaccgtccgtaccggcgtcctgcacctcgacctgtcg
gcccgcggcgtcgagcggacgcgcttccagcacgcccgcatcgacggcgtcaagccgctg
ctgacggggcgctggacgcgcgtcggctga

DBGET integrated database retrieval system