KEGG   Conexibacter woesei: Cwoe_4974Help
Entry
Cwoe_4974         CDS       T01153                                 

Definition
(GenBank) Triacylglycerol lipase
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Motif
Other DBs
NCBI-ProteinID: ADB53385
UniProt: D3FC90
Position
5303619..5304404
Genome map
AA seq 261 aa AA seqDB search
MEHHPRRAAVACALAIAALLIAAAGASAEKYVALGDSYSSGTGTRVYTDAGCQRSIYAYP
SLIDTQRPNTDLVFAACSGATTNSVLSGQVSSLTSDTAIVTITIGGNDAGFSSVVTQCAL
PWPWSCTTDLNNAQAFIRNTLPGRLDSVYAQIRTRSPSARVVVLGYPRLFMGVDCNGGTF
FSGDELTRMNQTADMLRDVTRGRAAAAGFSFADAIPAFTGHAVCSSTEWLNGLSNPVGES
YHPNRTGHSSGYAPLVRAIIG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggagcatcatccacgccgtgccgctgtcgcctgcgcgctcgcgatcgccgcactgctg
atcgccgccgccggcgcctcggcggagaagtacgtcgcactcggggactcgtactcgtcg
ggcaccgggacgcgcgtctacaccgacgccggctgccagcgcagcatctacgcgtacccg
tcgctgatcgacacgcagcgaccgaacaccgacctcgtcttcgcggcctgctcgggcgcg
acgaccaacagcgtgctcagcggccaggtgtcgtcgctgacgagcgacaccgcgatagtc
acgatcacgatcggcggcaacgacgccggcttctcgagcgtcgtcacgcagtgcgcgctg
ccgtggccgtggagctgcacgaccgatctcaacaacgcccaggcgttcatcagaaacacg
ctgccggggcggctcgactccgtctacgcgcagatcagaacgcgctcgccgagcgccaga
gtcgtcgtgctcggctacccgcggctgttcatgggggtcgattgcaacggcggcacgttc
ttcagcggcgacgagctgacgcgcatgaaccagaccgccgacatgctgcgcgacgtcacg
agaggccgtgccgccgcggcgggcttctcgttcgcggacgcgatcccggcattcaccggc
cacgcggtctgctccagcacggagtggctcaacggcctctccaacccggtcggcgagagc
taccacccgaacagaaccggccacagcagcggctacgcgccgctggtgcgggcgatcatc
ggctga

DBGET integrated database retrieval system