KEGG   Conexibacter woesei: Cwoe_4977Help
Entry
Cwoe_4977         CDS       T01153                                 

Definition
(GenBank) chalcone and stilbene synthase domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5306213..5307310
Genome map
AA seq 365 aa AA seqDB search
MNSATLAPTPAASGAAARRAGPLPTIAGLATAAPPQVYEQRDMLALLGLAGDEFAEGIFD
RCGVQRRHLGTPPELWATTLQARTAHTERLLAGLATQAVDQLDFDPADVAVVVAGTYYGL
GGPTIAHRIVEHCGLAPETDKYHLLGVGCASAVPLLRLAAQALSDHPGKQALVVAAECVS
GFLTTCAPGDAKVKIVGSSLFGDGCAAALLTLGEAREDTTPRPRILDSVVHQIPDSLDEV
RFAVTADDSHMNMSRALPVIAANDLRGLVDDFLARSGLTRGDVDHWIAHPGGRGILDGIR
AGLELTEEDVAPSAAVLAENGNVGTPSALFVLERVHELRDPQPGERGLMVTIGPGVTIGM
ALVQW
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgccacgctcgccccgactcccgccgcatccggtgccgccgcacgccgcgcc
ggaccgcttccgacgatcgccggcctcgccacggccgcgcccccgcaggtctacgagcag
cgcgacatgctcgcgctgcttggcctcgccggcgacgagttcgccgaagggatcttcgac
cgctgcggcgtccagcgccgccatctcggaacgccgccggagctgtgggcgacgacgctg
caggcgcgcaccgcgcacaccgagcggctgctcgccgggctcgcgacgcaggccgtcgac
cagctcgacttcgaccccgccgacgtcgcggtcgtcgtcgcgggcacctactacggactc
ggcggcccgacgatcgcccaccgcatcgtcgagcactgcggcctcgcgcccgagaccgac
aagtaccacctgctcggcgtcggctgcgcctccgccgtcccgctgctgcggctcgccgcg
caggcgctgagcgaccatcccggcaagcaggcgctcgtcgtcgcggcggagtgcgtcagc
ggcttcctgacgacctgcgcgccaggcgacgcgaaggtcaagatcgtcggctcctcgctg
ttcggcgacggctgcgccgccgcgctgctgacgctcggcgaggcgcgcgaggacacgacg
ccgcgcccgcggatcctcgacagcgtcgtccaccagatccccgactcgctcgacgaggtc
cgcttcgccgtcaccgccgacgacagccacatgaacatgagccgcgcgctgccggtgatc
gccgcgaacgacctgcgcgggctcgtcgacgacttcctcgcgcggagcgggctcacgcgc
ggcgacgtcgaccactggatcgcccaccccggcggccgcgggatcctcgacggcatccgc
gccgggctggagctgacggaagaggacgtcgcgccgagcgccgcggtgctcgccgagaac
ggcaacgtcggcacgccgtcggcgctgttcgtgctggagcgcgtgcacgagctgcgcgat
ccgcagccgggcgagcgcggcctgatggtgacgatcggaccgggcgtgacgatcggcatg
gcgctggtgcagtggtga

DBGET integrated database retrieval system