KEGG   Conexibacter woesei: Cwoe_4990Help
Entry
Cwoe_4990         CDS       T01153                                 

Definition
(GenBank) Stearoyl-CoA 9-desaturase
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5321076..5321999
Genome map
AA seq 307 aa AA seqDB search
MEPTADDVEPVANETRDRIITGLVTVVPVLALGLVAWQLWAVALGWSDLAVLAIMYVATG
LGITVGFHRLFTHRSFKTTPAVRAVLAGLGSAAIEGPVISWVADHRKHHAFSDRHGDPHS
PHVGHGHGWRGALRGLLHAHVGWLFIHTQRGRKERYAPDLMKDPVVAFVDRTFIWWAIGG
FLVAGALGFLLGGISWQAGLTGILWGGLVRTLLLHHATYSINSLCHFFGRRPFETGDESR
NLAWLAPLTFGEAWHNGHHAFPTSARHGVDRGQLDPSAGVIALLEKCGLAWDVVRVDERK
LEAKRTV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggagccaaccgccgacgacgtcgagccggtcgcgaacgagacgcgcgaccggatcatc
accggcctcgtgaccgtcgtgccggtgctggcgctgggcctcgtcgcctggcagctgtgg
gcggtcgcgctcggctggagcgacctcgccgtgctcgcgatcatgtacgtcgcgaccggc
ctcgggatcacggtcggcttccaccgcctgttcacgcaccgctcgttcaagacgacgccc
gcggtccgcgcggtgctcgccggactcggctccgcggcgatcgaagggccggtgatctcg
tgggtcgccgaccaccgcaagcaccacgccttctccgaccgccatggcgacccgcacagc
ccgcatgtcggccacggccacggctggcgcggcgcgctgcgcggcctgctccacgcgcac
gtcggctggctgttcatccacacccagcgcgggcgcaaggagcgctacgcgcccgacctg
atgaaggacccggtcgtcgcgttcgtcgaccgcacgttcatctggtgggcgatcggcggc
ttcctcgtcgccggcgcgctcggcttcctgctcggtgggatctcatggcaggcggggctg
accgggatcctgtggggcggcctggtgcggacgctgctgctgcaccacgcgacctactcg
atcaactcgctctgccacttcttcggccggcgcccgttcgagaccggcgacgagtcgcgc
aacctcgcctggctcgcgccgctgacgttcggcgaggcgtggcacaacggccaccacgcg
ttcccgacctccgcccgccacggggtcgaccgcggccagctcgacccctccgccggcgtg
atcgcgctgctggagaagtgcgggctggcgtgggacgtcgtgcgcgtcgacgagcgcaag
ctggaggcgaagcggaccgtctga

DBGET integrated database retrieval system