KEGG   Conexibacter woesei: Cwoe_4991Help
Entry
Cwoe_4991         CDS       T01153                                 

Definition
(GenBank) ABC-type sugar transport system periplasmic component-like protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_6 DUF1195
Motif
Other DBs
NCBI-ProteinID: ADB53402
UniProt: D3FCA7
Position
complement(5322042..5323199)
Genome map
AA seq 385 aa AA seqDB search
MERASEAPDGREDRRTSRRRFLEAAGLVGIGGLALSACGGGDDDTGVSTANASGSGTSTA
AASGAAAGLLGEPKKVIWALAAIAPWNLQLDVGFTEATRTLGWEYQKVGVPIAQYSAESV
VNVVSRAAAARPDVLVTPAWVPGLEKVVRKAQDDGILVMFNNANNLPELSNELGIAFIGA
DEYEGGKALAPVLFEAMRRAGKSDGVVLGGLPFPGNDNVEMRLEGARDGLMELNRLHGTN
FEYERFIDGSARGNAPAQTAYRAKLRQLGDDGVAGILSISDVNGVIPALRSSGVEPGEIP
IGTWDLLESTITGIEQGWVAGTVNAQPYQQGYIPVMLAWQEFERGQTPRDYDSGGAIVTQ
ATIAATARAEAIIRDKAKEYDIKLT
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagcaagcgaagcgcccgacgggcgcgaggaccgccgtacgtcgcgccgcagg
ttcctggaggcggccggcctcgtcggcatcggcgggctggcgctgtccgcctgcggcggc
ggtgacgacgacaccggcgtctcgaccgcgaacgcgagcggaagcggcacgtcgaccgcg
gccgcgagcggcgcggcggccggcctgctgggcgagccgaagaaggtgatctgggcgctc
gcggcgatcgcgccgtggaacctccagctcgacgtcggcttcaccgaggcgacgcggacg
ctcggctgggagtaccagaaggtcggcgtgccgatcgcgcagtactcggccgagtcggtc
gtcaacgtcgtcagccgcgccgccgcggcgcggcccgacgtgctcgtcacgccggcgtgg
gtcccggggctggagaaggtcgtgcgcaaggcgcaggacgacgggatcctcgtgatgttc
aacaacgccaacaacctgccggagctgtcgaacgagctgggcatcgcgttcatcggcgcc
gacgagtacgagggcgggaaggcgctcgcgccggtgctgttcgaggcgatgagaagagcc
ggcaagagcgacggcgtcgtgctcggcggcctcccgttccccggcaacgacaacgtcgag
atgcggctggagggcgcgcgcgacgggctgatggagctgaacagactgcacggcacgaac
ttcgagtacgagcgcttcatcgacggctcggcgagaggcaacgcgcccgcgcagacggcc
tacagagcgaagctgcgccagctcggtgacgacggcgtcgccgggatcctgtcgatctcc
gacgtcaacggcgtgatccccgcgctgcgctcctccggcgtcgagcccggcgagatcccg
atcggcacgtgggacctgctggagtcgacgatcaccggcatcgagcagggctgggtcgcc
ggtaccgtcaacgcgcagccctaccagcagggctacatcccggtgatgctcgcgtggcag
gagttcgagcgcggccagacgccgcgcgactacgacagcggcggcgcgatcgtcacgcag
gcgacgatcgccgcgacggcgagagccgaggcgatcatccgcgacaaggcgaaggagtac
gacatcaagctgacgtga

DBGET integrated database retrieval system