KEGG   Conexibacter woesei: Cwoe_5002Help
Entry
Cwoe_5002         CDS       T01153                                 

Definition
(GenBank) cold-shock DNA-binding domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: ADB53413
UniProt: D3FCB8
Position
complement(5333235..5333438)
Genome map
AA seq 67 aa AA seqDB search
MATGTVKWFSDDKGFGFITPDDQSKDLFVHHTGIISDGYRSLPEGAKVSYDSEPGPKGPK
AVNVQQI
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaaccgtcaagtggttcagcgacgacaagggcttcggcttcatcacccct
gatgaccagtcgaaggacctcttcgtccatcacaccggcatcatcagcgacggctaccgc
tcgctgcccgagggcgcgaaggtctcgtacgactccgagcccggcccgaagggccccaag
gcggtcaacgtccagcagatctga

DBGET integrated database retrieval system