KEGG   Conexibacter woesei: Cwoe_5003Help
Entry
Cwoe_5003         CDS       T01153                                 

Definition
(GenBank) Endoribonuclease L-PSP
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5333630..5334001)
Genome map
AA seq 123 aa AA seqDB search
MKTIELPGLSAAPLNAATVVDGTIYTSGQVGRDRVSGETPADLEGQVRATIANLEYVLEA
AGGSLATVVKTVVFLTDASDFAEMNRVYAELMPQPYAPRSTVVVGLAHDYLKFEIEVIAR
VAS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcgagctgcccggcctcagcgccgcgcccctcaacgccgcgaccgtcgtc
gacggcacgatctacacctccggccaggtcggccgcgaccgcgtcagcggcgagacgccg
gccgacctcgagggccaggtgcgcgcgacgatcgcgaacctcgagtacgtgctggaggcg
gcgggcggctcgctcgcgacggtcgtcaagaccgtcgtcttcctcaccgacgcgagcgac
ttcgcggagatgaaccgcgtctacgccgagctgatgccgcagccgtacgcgccgcgctcg
acggtcgtcgtcggcctcgcgcacgactacctgaagttcgagatcgaggtgatcgcgcgc
gtcgcgtcctga

DBGET integrated database retrieval system