KEGG   Conexibacter woesei: Cwoe_5006Help
Entry
Cwoe_5006         CDS       T01153                                 

Definition
(GenBank) cyclase family protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5335418..5336212)
Genome map
AA seq 264 aa AA seqDB search
MTASSISAAAGIAAPSTDRPGTREVYDLSLPFRRDMPSYYFYENRYQPPMFTVFSHKEGT
PLGPETKDGYVTHVSFLTHTGTHVDAPRHFRDDGQYLHEVPADRWLGEGPILSVPKEEME
PITAEDLERACAESGLDVRPGDIVGINTGWHRRFCGPGEDRDQAIEYMERNPGLSRESAE
WLVAKGIVTVMIDSPAIDCARFMPYGDSSFQSHYALFAENVPAVEGLGGQLDEVTGKRCL
ISCAPVRYENGDAFPLRVLASPLP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttcatccatcagcgccgcggccggcatcgccgcgccgtcgaccgaccgcccc
ggcacgcgcgaggtctacgacctcagcctcccgttccggcgcgacatgccctcgtactac
ttctacgagaaccgctaccagccgccgatgttcaccgtcttcagccacaaggaggggacg
ccgctggggccggagacgaaggacggctacgtcacgcacgtctcgttcctgacgcacacc
ggcacgcacgtcgacgcgccgcgtcacttccgcgacgacggccagtacctgcacgaggtg
ccggccgaccgctggctcggcgagggcccgatcctgtcggtcccgaaggaggagatggag
ccgatcacggcagaggacctggagcgcgcctgcgcggagtccggcctcgacgtccgtccc
ggcgacatcgtcggcatcaacaccggctggcaccgccgtttctgcggcccgggcgaggac
cgcgaccaggcgatcgagtacatggagcgcaaccccgggctgtcgagagagagcgccgag
tggctggtcgcgaaggggatcgtcaccgtgatgatcgactcgccggcgatcgactgcgcc
cgcttcatgccgtacggcgactcctcgttccagagccactacgcgctgttcgccgagaac
gtgccggcggtcgaggggctgggcggccagctcgacgaggtgacgggcaagcgctgcctg
atcagctgcgcgccggtccgctacgagaacggcgacgcgttcccgctgcgcgtcctggcg
agcccgctgccatga

DBGET integrated database retrieval system