KEGG   Conexibacter woesei: Cwoe_5009Help
Entry
Cwoe_5009         CDS       T01153                                 

Definition
(GenBank) Glyoxylate reductase
  KO
K00015  
glyoxylate reductase [EC:1.1.1.26]
Organism
cwo  Conexibacter woesei
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cwoe_5009
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     Cwoe_5009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5338206..5339243)
Genome map
AA seq 345 aa AA seqDB search
MSGAASGAGAPAPGAVPARPRIVVAREIPAPALDLLREAGELWVSPHDRPLTPEELRAAA
AGADALVTLLHDRVDGELLDAAGPRLRVVANVAVGYDNLDVPAATARGVRVTNTPGVLTD
ATADLALALLLAATRRIGEGERLIRAGTPWSWRMDFLLGAGLQGRTLGIVGLGDIGRATA
RRARAFGMEIAYAGRRAAPPEVEAELGGARRLPLDELIASVDVISLHCPLTPETHHLLNA
ERLATMRPGSYLVNTARGPIVDEAALAVALRDGPLAGAALDVFEHEPRVHPALVELDNVV
LAPHLGSATVETRTAMALLAARNAVAVLRGEEPPAPLNTASKPAS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgcggcttccggcgccggcgcgcccgcgcccggcgccgtccccgcgcgcccg
cgcatcgtcgtcgcgcgcgagatccccgcgcccgcgctcgacctgctgcgcgaggcgggc
gagctgtgggtctcgccgcacgaccggccgctgacgccggaggagctgcgcgccgcggcg
gccggcgccgacgcgctcgtcacgctgctgcacgaccgcgtcgacggcgagctgctcgac
gccgccggcccgcggctgcgcgtcgtcgccaacgtcgcggtcggctacgacaacctcgac
gtccccgccgcgaccgcgcgcggcgtgcgcgtcacgaacacgcccggcgtgctgaccgac
gcgaccgccgacctcgcgctcgcgctgctgctggccgcgacccgccgcatcggcgagggc
gagcggctgatccgcgccggcacgccgtggagctggcggatggacttcctgctcggcgcc
ggcctgcagggccgcacgctcgggatcgtcgggctcggcgacatcggtcgcgcgaccgcg
cggcgggcgcgggcgttcgggatggagatcgcctatgccggccgccgtgccgcgccgcct
gaggtcgaggcggagctgggcggcgcgcggcggctcccgctcgacgagctgatcgcctcg
gtcgacgtgatctcgctccactgcccgctgacgccggagacccaccacctgctcaacgcc
gagcggctcgcgacgatgcgaccgggctcctacctcgtcaacaccgcgcgcgggccgatc
gtcgacgaggcggcgctcgcggtcgcgctgcgggacggcccgctcgccggcgccgcgctc
gacgtcttcgagcacgagccgcgcgtgcaccctgcgctggtcgagctggacaacgtcgtg
ctggcgccgcacctcggctcggcgaccgtcgagacgcgcaccgcgatggcgctgctggcg
gcccgcaacgccgtcgccgtgctgcgcggcgaggagccgccggcgccgctcaacacggcg
tcgaaaccggcctcctga

DBGET integrated database retrieval system