KEGG   Conexibacter woesei: Cwoe_5011Help
Entry
Cwoe_5011         CDS       T01153                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5341123..5342094)
Genome map
AA seq 323 aa AA seqDB search
MPEVLAVDGLVKQFEQRVGTFRHATLHAVDGVSLTVDSDDCVGVVGESGCGKSTLARMMV
GLERPTAGAVRFDGGEITADGDWKQLRRAVQYVFQDPYGSLPPKMSIGAVLEDPLKIAKT
GDAASRRARVERAVELVGLRASDLARYPSEFSGGQRQRISVARALIQDPRVVIFDEVTSG
LDVSIQAQVLNLLVELQNSLSVGYVFISHDLRVIRYLARSVVVMYLGRVVEAGPVEDVFA
RPLHPYTQGLLRSIPDHSRLTAGGPRQRLARIGGEPPSPVERPPGCPFAPRCPAAQSLCR
EQEPGESVVEGVRVRCHFPGAAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggtgctggcggtcgacggactcgtgaagcagttcgagcagcgcgtcgggacg
ttcagacacgcgaccctccacgcggtcgacggcgtctcgctgacggtcgactccgacgac
tgcgtcggcgtcgtcggcgagagcggctgcggcaagtcgacgctcgcgcggatgatggtc
ggcctggagcggccgaccgccggcgcggtccgcttcgacggcggcgagatcaccgccgac
ggcgactggaagcagctccgccgcgcggtccagtacgtcttccaggacccgtacggatcg
ctgccgccgaagatgtcgatcggcgccgtgctggaggacccgctcaagatcgccaagacg
ggcgacgccgcctcgcgccgcgcgcgcgtcgagagagcggtcgagctggtcggcctgcgc
gcgagcgacctcgcgcggtacccgtcggagttcagcggcggccagcgccagcgcatcagc
gtcgcgcgcgccctgatccaggacccgcgcgtggtgatcttcgacgaggtcacctccggc
ctcgacgtctcgatccaggcgcaggtgctgaacctgctcgtcgagctgcagaactcgctc
tcggtcggctacgtcttcatctcgcacgacctgcgcgtgatccgctacctcgcgcgctcg
gtcgtcgtgatgtacctcggccgcgtcgtcgaggcgggaccggtcgaggacgtcttcgcg
cggccgctgcacccgtacacgcaggggctgctgcggtcgatccccgaccacagtcgcctc
accgccggcggcccgcgccagcgcctcgcgcgcatcggcggcgagccgccgagcccggtc
gaacgcccgcccggctgcccgttcgccccgcgctgtcccgccgcccagtcgctctgccgc
gagcaggagccgggcgagtccgtcgtcgagggcgtccgcgtccgctgccacttccccgga
gccgccgcatga

DBGET integrated database retrieval system