KEGG   Conexibacter woesei: Cwoe_5012Help
Entry
Cwoe_5012         CDS       T01153                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
  KO
K02031  
peptide/nickel transport system ATP-binding protein
Organism
cwo  Conexibacter woesei
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cwoe_5012
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Cwoe_5012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5342087..5343103)
Genome map
AA seq 338 aa AA seqDB search
MTAPTTQAAVAAPLLEIDGLTVQFPTPAGPMSVVRDVSFAVAAGECLGIVGESGSGKSMT
SRAVLRLVPPPGRIAGGSVRFDGTDLLTLTEKQMRSVRGAQISMVFQDPTASLNPLFSIG
RQLTDVIRTHTDAGRAEARRRAVEVLDQVGFADARRRLRAYPFELSGGLRQRVSIALALA
CGPKLVIADEPTTNLDVSIQAQIIDLLLQLKNDVGFAILFISHDLGVVASIADRVSIMYA
GRALETGPASAVLAQPSHPYTQRLLRSAPTLESRRADGLPSIPGAAPQLGELPAGCPFTA
RCELAIEGVCAEVEPVWTDLGDGRAAMCHLLEKELANA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccgaccactcaggccgctgtggccgctccgctgctggagatcgacggtctc
accgtgcagttcccgacgcccgccggaccgatgtccgtcgtgcgcgacgtctcgttcgcg
gtcgccgccggcgagtgcctcgggatcgtcggcgagtccggctcgggcaagtcgatgacc
tcccgcgccgtgctgcggctggtgccgccgccgggccggatcgccggcggcagcgttcgc
ttcgacgggaccgacctgctgacgctgaccgagaagcagatgcggtccgtgcgcggcgcg
cagatctcgatggtcttccaggacccgaccgcgtcgctgaacccgctcttctcgatcggc
cgccagctgaccgacgtgatccgcacgcacaccgacgcggggcgcgccgaggcgcgcaga
cgcgcggtcgaggtgctcgatcaggtcggcttcgccgatgcgagacggcggctgcgggcg
tacccgttcgagctgtccggcgggctgcgccagcgcgtctcgatcgcgctcgcgctcgcc
tgcgggccgaagctggtgatcgccgacgagccgacgacgaacctcgacgtctcgatccag
gcgcagatcatcgacctgctgctgcagctgaagaacgacgtcggcttcgcgatcctgttc
atcagccacgacctcggcgtcgtcgcctcgatcgcggaccgcgtctcgatcatgtacgcc
ggccgcgcgctcgagaccggtcccgcgagcgcggtgctggcgcagccgagccatccgtac
acgcagcggctgctgcgctcggcgccgacgctggagagccgccgcgccgacgggctgccg
agcatccccggcgccgcgccgcagctcggcgagctgccggccggctgcccgttcaccgcc
cgctgcgagctggcgatagagggcgtctgcgctgaggtcgagccggtctggaccgacctc
ggcgacggccgcgccgcgatgtgccatctgttggagaaggagctggcgaatgcctga

DBGET integrated database retrieval system