KEGG   Conexibacter woesei: Cwoe_5019Help
Entry
Cwoe_5019         CDS       T01153                                 

Definition
(GenBank) glycerate kinase
  KO
K00865  
glycerate 2-kinase [EC:2.7.1.165]
Organism
cwo  Conexibacter woesei
Pathway
Glycine, serine and threonine metabolism
Glycerolipid metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cwoe_5019
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cwoe_5019
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cwoe_5019
Enzymes [BR:cwo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     Cwoe_5019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5350953..5352041)
Genome map
AA seq 362 aa AA seqDB search
MLCAPDKLRGALDARGAAHALAEGARAAGGVPHELPIADGGEGTLDAFLDGATVHELTVE
DALGRPRSARLLELADAPDPATAAGGTFLVEAAEAVPLHALAEHERDVERASSYGAGELV
RAALDRGARRILIAVGGVATVDGGAGALQALGARCPRDGAGLLAAPEIDRSDLDPRLAGV
EIELLVDVAAPLTGPDGAAHRFGPQKGATPEQIAALDSALTRWADALGIDPATPGAGAAG
GLGAAFQAIGARTVAGADAVLELTGFDTLLAEADLVLTAEGSVDASTLQGKAVAAVVAHC
AKAGVPVEVFGGRVIDEAAVELRRRGARDVRPLGPAGRPLAEAFAAAADELAAAAEAATR
RT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgctctgcgccccggacaagctgcgcggcgcgctcgacgcgcgcggcgcggcgcacgcg
ctcgcggagggcgcgcgagcggccggcggagtgccgcacgagctgccgatcgccgacggc
ggcgagggaacgctcgacgcgttcctcgacggcgcgaccgtccacgagctgaccgtcgag
gacgcgctcggccgcccgcgcagcgcgcggctgctggagctggccgacgcgcccgacccg
gccacggccgccggggggacgtttctggtcgaggccgccgaggcggtgccgctgcacgcg
ctcgccgagcacgagcgcgacgtcgagcgggcgtcgtcctacggtgccggcgagctggtg
cgcgcggcgctcgaccgcggcgcgcggcggatcctgatcgccgtcggaggggtcgcgacg
gtcgacggcggcgcgggtgcgctgcaggcgctcggcgcgcgctgcccgcgcgacggcgcc
ggtctgctcgccgcgccggagatcgaccgcagcgacctcgacccgcgcctcgccggcgtc
gagatcgagctgctggtggacgtcgccgcgccgctgaccgggcccgacggcgccgcgcac
cgcttcggcccgcagaagggcgccacgccggagcagatcgccgcgctcgacagcgccctc
acgcgctgggccgacgcgctcgggatcgaccccgcgacgcccggcgccggcgcggccggc
ggcctcggcgccgccttccaggcgatcggcgcgcgcaccgtcgcgggcgccgacgccgtg
ctggagctgaccggcttcgacacgctgctggccgaggccgacctcgtgctgaccgccgag
ggatcggtcgacgcctcgacgctccagggcaaggcggtcgccgccgtcgtcgcgcactgc
gccaaggccggcgtcccggtcgaggtcttcggcggccgcgtcatcgacgaggccgccgtc
gagctgcggcgccgcggcgcgcgcgacgtgcgcccgctcggccccgccggccgcccgctc
gccgaggcgttcgcggcagccgcagacgagctggccgccgcggccgaggctgcgacgcgc
cggacctga

DBGET integrated database retrieval system