KEGG   Conexibacter woesei: Cwoe_5032Help
Entry
Cwoe_5032         CDS       T01153                                 

Definition
(GenBank) ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
cwo  Conexibacter woesei
Pathway
cwo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cwoe_5032
Transporters [BR:cwo02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Cwoe_5032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_16 SMC_N AAA_29 AAA_30 AAA_25 RsgA_GTPase AAA_22 Zeta_toxin AAA_28 AAA_33 AAA_23 MMR_HSR1 AAA_18 NACHT
Motif
Other DBs
NCBI-ProteinID: ADB53443
UniProt: D3FD51
Position
5364243..5365958
Genome map
AA seq 571 aa AA seqDB search
MTPREVHRRLLGLAGGTRVLLGGAVAAGLAGAVLLVVQALALARIVDGAAFGGKDLAALR
PLVVTLALALAGRALLATLTEWLGRRAAEHAMGALRHRVAAHVLAARTPRVEDARRGELA
TAAVHGVDALAEYYAKAVPQIALAAAVPVGLVGVILWHDPLVGALLAVTLPLVVVFMVLV
GRESAERIDERRLALGVLGSHFLDVVRGLPTLRAHGRAEAQAETLGAIGERYRSESVAAL
RVAFLSALVLELMAMVGTAIAAAVVGVQLAGGSLGFEAGLLVLLLAPEVYVPLRLAGQRY
HAAEDGAAAAQTLLELLDEPVGGRSGDLTTVGVVNPPLLDPPDPARAPLTLRGVRVDGGA
GRPPALDGLDLTLTPGRLTALVGASGAGKSTLLRLLARLAEPDEGAVLCGATDLRAVASE
AWWPRIAWLPQRAALLRGPLEEMLRLQCPDAPGDALALALRRADADAIVAALPAGLATPV
GAGGRGFSGGQAQRLALAGALLSTAPLLLLDEPTAHLDPASATMVAAGIRAAAAGRTAIV
STHDPALVAVCDEVVALEAGRVAELLEGAAA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcgcgaggtccaccgccggctgctcggcctcgccggcggcacgcgcgtgctg
ctcggcggcgcggtcgcggcgggcctcgcgggcgcggtgctgctcgtcgtgcaggcgctc
gcgctcgcgcggatcgtcgacggcgccgcgttcggcggcaaggacctcgcggcgctgcgg
ccgttggtcgtgacgctcgcgctcgcgctcgccggccgcgcgctgctggcgacgctgacc
gaatggctcgggcgccgcgcggccgagcacgcgatgggcgcgctgcgccaccgcgtcgcc
gcgcacgtgctggcggcgcgcacgccgcgcgtcgaggacgcccgccgcggcgagctggcg
acggccgcggtccacggcgtcgacgcgctcgccgagtactacgcgaaggcggtcccgcag
atcgcgctcgcggcggcggtgcccgtcgggctcgtcggcgtgatcctctggcacgacccg
ctcgtcggcgcgctgctggcggtgacgctcccgctcgtcgtcgtcttcatggtgctcgtc
gggcgcgagtcggcggagcggatcgacgagcggcggctggcgctcggggtgctcggctcg
cacttcctcgacgtcgtgcgcggcctgccgaccctgcgcgcccacggccgcgccgaggcg
caggcggagacgctcggggcgatcggcgagcgctaccgcagcgagtcggtcgccgcgctg
cgggtcgcgttcctgtccgcgctcgtgctggagctgatggcgatggtcgggaccgcgatc
gccgccgcggtcgtcggcgtccagctcgccggcggctcgctcggcttcgaagccggcctg
ctcgtcctgctgctcgcgcccgaggtctacgtcccgctccggctcgccggccagcgctac
cacgccgccgaggacggcgccgccgccgcgcagacgctgctggaactgctcgacgagccg
gtcggcgggaggagtggagatctgaccaccgtgggcgtggtcaatcctccactcctcgat
ccgcccgaccccgcccgcgccccgctcacgctccgcggcgtgcgggtcgacggcggagcg
gggcggccgccggcgctcgacgggctcgacctgacgctcacgcccgggcgcttgactgcg
ctcgtcggcgcgtccggtgcgggcaagtcgacgctgctgcgactgctcgcccgcctcgcc
gagccggacgagggggccgtcctctgcggcgcgaccgacctgcgcgccgtcgcgtccgag
gcgtggtggccgcgaatcgcctggctgccccagcgcgcggcgctgctgcgcggaccgttg
gaggagatgctgcgcctgcagtgccccgacgcgcccggcgacgcgctcgcgctggcgctg
cgacgggcggacgctgacgcgatcgtcgccgcgctgccggccgggctcgcgacgccggtc
ggcgccggcggccgtggcttctccggcgggcaggcgcagcggctggcgctcgccggcgcg
ctgctctccaccgctccgctgctgctgctcgacgagccgaccgcccacctcgacccggcc
agcgcgacgatggtcgccgccggcatccgcgctgccgccgccggccgcaccgccatcgtc
tcgacccacgatcccgcgctcgtcgcggtctgcgacgaggtcgtggcgctcgaagccggc
cgcgtcgcggagctgctggaaggagccgcggcgtga

DBGET integrated database retrieval system