KEGG   Conexibacter woesei: Cwoe_5035Help
Entry
Cwoe_5035         CDS       T01153                                 

Definition
(GenBank) NHL repeat containing protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NHL
Motif
Other DBs
NCBI-ProteinID: ADB53446
UniProt: D3FD54
Position
complement(5368651..5370018)
Genome map
AA seq 455 aa AA seqDB search
MRTARLLPPFLLAGALLGPLAGVAAAAPAVDGEFALGAQPRHLALGPDGNMWVALDGVAD
DVAKVAPDGSVTKYTAAAITNPVGIAAGPDGNLWVTQNGAVVRFSPADPTTARAFPVPQI
VDPRAIVSGPDGNLWTASADRAIQVTTAGVARDFTVPGMGARGIARGGDGDLYIADFGGQ
RVVGLTTAGVPTFYRTGGGPQEVAAGPDGRIAYTNPTNVPQQVGRFVRGGSVATTDVPGT
DPFGITLGDDGAWWTADFARSTISRLTTDGAVTPLAGLSAGSGPRFVATGAGGTLWVALE
TSQRVARVTGVTAPPPPPPPAPPAPPAPPRPVDPRPADRLAPRIALTLPRRIVAGRALTA
RIALSEPSALTIRFQRVLPGRRAGRACVRPTPRLRRARRCTRAVTVAKATRRAGGLRVRV
VIAGRRVRAGPSRLVVTATDANGNRTTHVVRLTVR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccgcacgcctgcttcccccgttcctgctcgccggagcgctgctcggcccgctc
gcgggcgtcgccgcggccgcgcccgccgtcgacggcgagttcgcgctcggcgcccagccg
cgccatctcgcgctcggccccgacgggaacatgtgggtcgcgctcgacggcgtcgccgac
gacgtcgcgaaggtcgcgcccgacggcagcgtgacgaagtacacggccgcggcgatcacg
aacccggtcgggatcgcggccggccccgacggcaacctgtgggtcacccagaacggcgcc
gtcgtgcgcttctcgcccgccgacccgacgaccgcgagagcgttccccgtcccgcagatc
gtcgatccgcgcgcgatcgtcagcgggccggacggcaacctctggaccgcctccgccgac
agagcgatccaggtcacgaccgccggcgtcgcgagagacttcaccgtcccagggatgggc
gcgcgcgggatcgcgcgcggcggcgacggcgacctctacatcgccgacttcggcggccag
cgggtcgtcgggctgacgaccgcgggcgtgccgacgttctacagaaccggcggcgggccg
caggaggtcgcggcgggccccgacggccgcatcgcctacaccaacccgacgaacgtgccg
cagcaggtcggccgcttcgtgcgcggcggcagcgtcgccacgaccgacgttcccgggacc
gacccgttcggcatcacgctcggcgacgacggcgcctggtggacggccgacttcgccaga
tcgacgatcagccgcctgacgaccgacggcgccgtgacgccgctcgccggcctcagcgcc
gggtccggcccgcgcttcgtcgcgaccggcgctggcggcacgctgtgggtcgcgctggag
acgtcgcagagagtcgcgcgcgtgacgggtgtgaccgcgccgccgccgccgcccccgccc
gcaccgccggccccgcccgcgcctccgcggcccgtcgacccgcgtccggccgaccgcctc
gctccgcgcatcgcgctcacgctgccgagacggatcgtcgccgggcgcgcgctgacggcg
cggatcgcgctctccgagccgtccgcgctgacgatccgcttccagcgtgtcctgcccggc
cgccgcgccggccgcgcgtgcgtgcgaccgacgccgcggctgcgcagagcgcgccgctgc
acccgcgccgtcaccgtcgcgaaggcgacgcggcgtgccggcggtctgcgcgtgagggtg
gtcatcgccggccggcgcgtgagagcgggaccgagccgcctcgtcgtgaccgcgaccgac
gcgaacggcaaccgcacgacgcacgtggtgcggctgaccgtgcgctga

DBGET integrated database retrieval system