KEGG   Conexibacter woesei: Cwoe_5036Help
Entry
Cwoe_5036         CDS       T01153                                 

Definition
(GenBank) HhH-GPD family protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-ProteinID: ADB53447
UniProt: D3FD55
Position
5370148..5370699
Genome map
AA seq 183 aa AA seqDB search
MPERLHFTEDDAANALIASDPMALLVGFALDQQVTVQKAFAGPLVLQERLGAIDAATLAD
ADLEPVFREKPALHRYPGAMAKRVHELAVHVRDRYDGDAARVWTAAADAGELRANLEALP
GFGEMKVKSLGAVLAKQYGVAAAQELVPWHPTLGDVDSQQALADYQAAKKLHKAEWSKAH
TAS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagcgcctgcacttcaccgaggacgacgccgcgaacgcgctgatcgcgtcggac
ccgatggcgctgctggtcggcttcgcgctcgaccagcaggtgaccgtgcagaaggcgttc
gccggtccgctggtgctgcaggagcggctcggcgcgatcgacgcggcgacgctcgccgac
gcggacctggagccggtcttccgcgagaagccggcgctccaccgctacccgggcgcaatg
gccaagcgcgtccacgagctggccgtgcacgtgcgcgaccgctacgacggcgacgccgcg
cgcgtctggaccgccgccgccgacgccggcgagctgcgcgcgaacctcgaggcgctgccg
ggcttcggcgagatgaaggtcaagtcgctcggcgccgtgctcgccaagcagtacggcgtc
gccgccgcgcaggagctggtgccctggcacccgacgctcggcgacgtcgactcgcagcag
gccctggccgactaccaggccgccaagaagctgcacaaggcggagtggtcgaaggcgcac
accgcctcgtag

DBGET integrated database retrieval system