KEGG   Conexibacter woesei: Cwoe_5039Help
Entry
Cwoe_5039         CDS       T01153                                 

Definition
(GenBank) Gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cwo  Conexibacter woesei
Pathway
cwo00430  Taurine and hypotaurine metabolism
cwo00460  Cyanoamino acid metabolism
cwo00480  Glutathione metabolism
cwo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Cwoe_5039
   00460 Cyanoamino acid metabolism
    Cwoe_5039
   00480 Glutathione metabolism
    Cwoe_5039
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Cwoe_5039
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     Cwoe_5039
Peptidases [BR:cwo01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   Cwoe_5039
CD molecules [BR:cwo04090]
 Proteins
  Cwoe_5039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ADB53450
UniProt: D3FD58
Position
5371693..5373267
Genome map
AA seq 524 aa AA seqDB search
MPEYAIATPQLDATAAGVAAFEAGGNALDAALAAAAALCVTYPHNCALGGDLFALVRSPE
GETTSVNASGPAARAADADALRARGATMPVTGPDTITVPGLVAGWEALHGLGAVRPWDAA
LDAATALASDGFAVGRSLAEAIDDARAGIAADPGLRGVLTPGGRPATEGTTLRQPALART
LRTLAADGPRAFYEGPLAERLIAGLRAAGCALDTDDLAGFRAELTAPLRHRCGELDVLTS
PPNSSGVLLPQALAALAASGAQDPLGADAGFLAELLRLGAEQRDAQLADPRATLTDLDAW
LGSERIAELVRRARARAQGDAPAPSGERSARPGGDTIAVVAVDAEGRAVSLIQSVFHSLG
SLLLEPATGVLMHNRGAFFSLVPGHPNELAPGRRPAHTLMPVLVERDGALRYALGTMGGK
AHAQIHSQVLLRLEAGEDPQAAVAAPRWVVGGVEVGERDDTVRVEDDVDPVARAAIERAG
MRPVAVGVHSEWCGHAQAISVAPDGALTAGSDPRADGGAVVGTL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagtacgcgatcgccacaccccagctcgacgccaccgccgccggcgtcgccgcc
ttcgaggccggcggcaacgcgctcgacgccgcgctcgccgcggccgcggcgctgtgcgtc
acctacccgcacaactgcgcgctcggcggcgacctgttcgcgctcgtgcgctcgcccgag
ggcgagacgacgagcgtcaacgcgagcggccccgccgcccgcgccgcggacgccgacgcg
ctgcgagcccgcggcgcgacgatgcccgtcaccggcccggacacgatcacggtcccgggc
ctcgtcgccggctgggaggcgctgcacggcctcggcgcggtgcgcccctgggacgccgcg
ctcgacgccgcgaccgcgctcgcgagcgacggcttcgccgtcggccgctcgctcgcggag
gcgatcgacgacgcccgtgccgggatcgccgccgacccgggcctgcgcggggtcctgacg
cccggcggccggccggcgacggagggcacgacgctgcgccagccggcgctcgcgcggacg
ctgcggacgctcgccgccgacggtccgcgcgccttctacgaggggccgctcgccgagcgg
ctgatcgccggcctgcgcgctgccggctgcgcactcgacacggacgacctcgccggcttc
cgcgccgagctgaccgcgccgctgcgccaccgctgcggcgagctggacgtgctgacgagt
ccgccgaactcctccggcgtgctgctgccgcaggcgctcgcggcgctcgccgccagcggc
gcccaggacccgctcggcgcggacgccggcttcctcgccgagctgctgcggctcggcgcc
gagcagcgcgacgcgcagctcgccgacccgcgcgcgacgctgacggacctcgacgcctgg
ctcggctccgagcggatcgccgagctggtgcgccgcgcccgcgcccgtgcgcagggcgac
gcgcccgcgccgtccggcgagcgctccgcgcgccccggcggcgacacgatcgcggtcgtc
gccgtggacgccgagggccgtgccgtctcgctgatccagagcgtcttccactcgctcggc
tcgctgctgctggagcctgcgaccggcgtgctgatgcacaaccgcggcgcgttcttctcg
ctcgtccccggccacccgaacgagctggcgccgggccggcgcccggcgcacacgctgatg
ccggtgctggtcgagcgggacggcgcgctgcgctacgcgctcggcacgatgggcggcaag
gcgcacgcgcagatccactcccaggtgctgctgcgactcgaagccggcgaggacccgcag
gccgcggtcgccgcgccgcgctgggtcgtcggcggcgtcgaggtcggcgagcgcgacgac
accgtccgcgtcgaggacgacgtcgaccccgtcgcccgcgccgcgatcgagcgcgccggc
atgcgccccgtcgcggtcggggtccacagcgagtggtgcggccacgcccaggcgatctcc
gtcgcccccgacggcgccctcaccgccggcagcgacccgcgcgccgacggcggcgcggtc
gtcgggaccctctag

DBGET integrated database retrieval system