KEGG   Conexibacter woesei: Cwoe_5046Help
Entry
Cwoe_5046         CDS       T01153                                 

Definition
(GenBank) GntR domain protein
  KO
K05799  GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex
Organism
cwo  Conexibacter woesei
Brite
Transcription factors [BR:cwo03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    Cwoe_5046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR TrmB HTH_Crp_2 MarR_2 LexA_DNA_bind HTH_11 MarR Fe_dep_repress HTH_CodY HTH_24 FaeA HTH_36 HTH_41 HTH_29 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ADB53457
UniProt: D3FD65
Position
complement(5379930..5380652)
Genome map
AA seq 240 aa AA seqDB search
MTANTPVDWSALATRPVHVSDNLSAKLEHMILTGELAEGARLPPEREFAVQLGVSRASVR
EALRELELKGMIDRRPGRGTIVADASPMLQSGSLLAVMSDSERSVSQVMDLRATIEPPIA
GRAASRATARDIERLTAIQRELEGRRSAARAVELDVEFHQEIARATHNPLLVKLAEVASE
WMAPSRNRPLQSRRRRSRSLTAHGTILAAIAAHDPAAAAAAMAEHIADVNQLLVDEGLRP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaacacgccagtcgactggtcggccctcgcgacgaggccggtccatgtctcg
gacaacctctcggccaagctcgagcacatgatcctgacgggcgagctggcggaaggggcg
cggttgccgcccgagcgcgagttcgccgtccagctcggcgtctcgcgcgcaagcgtgcgc
gaagcgctgcgcgagctggagctgaaggggatgatcgaccgccgccccggccgcggcacg
atcgtcgccgacgccagcccgatgctgcagagcggcagcctgctcgccgtcatgtccgac
tccgagcgctccgtctcgcaggtgatggacctgcgcgcgacgatcgagccgccgatcgcg
ggccgcgccgccagccgcgcgaccgcgcgcgacatcgagcggctgaccgcgatccagcgc
gagctggagggcagaagatcggcggcgcgcgcggtcgagctcgacgtcgagttccaccag
gagatcgcccgcgcgacccacaacccgctgctggtgaagctggccgaggtcgcgtcggag
tggatggcgccgagccgcaaccggccgctgcagagccgcaggcgccgcagcaggtcgctg
acggcgcacggcacgatcctcgcggcgatcgccgcgcacgaccccgccgccgcagcagcc
gcgatggcggagcacatcgccgacgtcaaccagctgctcgtcgacgagggcctgcggccg
tag

DBGET integrated database retrieval system