KEGG   Conexibacter woesei: Cwoe_5049Help
Entry
Cwoe_5049         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB53460
UniProt: D3FD68
Position
complement(5382563..5383414)
Genome map
AA seq 283 aa AA seqDB search
MTTPDERFEERLLSELRHVVAERPAPAPPGAAATGPPRRTPRLTRSRLAIGAAATAAATA
VAAVVLASGGTSTPAYAVEPTADGSVTVEINSLRDAAGLEQKLREAGIPAVVDYVPEGEM
CRADRSRAPVARERGAVRGGPPSMGVELRDGSARFTIARGSVKSDETLVIASSVGQGVSS
VATTIADGPVPPCELVDAGTSGGAATIEAIPIPPGGEGAGGAVPASPAEPSLQEAPEAGS
GAAGPSMQVGPEAGTDRAGPNTEVAPQAGTDGAAAGGTSSGGK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccccgacgagcgcttcgaggagcggctgctgtccgagctgcgccacgtcgtc
gccgagcgccccgcgcccgcgccgcccggcgccgccgcgaccgggccgccccgccgcacc
ccgcggctgacgcgatcgcggctggcgatcggcgccgccgcgaccgccgcggcgaccgcg
gtcgccgcggtcgtgctcgcctccggcggcacgagcacgccggcctacgccgtcgagccg
accgccgacggcagcgtgacggtcgagatcaacagcctgcgcgacgccgccgggctggag
cagaagctgcgcgaggccgggatcccggccgtcgtcgactacgtgcccgagggcgagatg
tgccgcgccgacagatcccgcgcgcccgtcgcgcgcgagcgcggcgcggtgagaggcggg
ccgccgtcgatgggcgtggagctgcgcgacggctcggcgcgcttcacgatcgcgcgcggc
agcgtcaagagcgatgagacgctcgtgatcgccagcagcgtcggtcagggggtgtcgtcg
gtcgccaccacgatcgcggacggcccagtcccgccgtgcgagctggtcgacgcgggcacg
agcggcggcgctgccacgatcgaggcgatcccgatcccgccgggtggcgagggcgccggg
ggcgccgtgcccgcgagcccggcggagccgagcctgcaggaggcgccggaggccggcagc
ggcgccgccgggccgagcatgcaggtcgggccggaggccggcaccgaccgcgccgggccg
aacaccgaggtcgcgccgcaggccggcaccgacggcgccgccgccggcggcacgagcagc
ggcgggaagtag

DBGET integrated database retrieval system