KEGG   Conexibacter woesei: Cwoe_5052Help
Entry
Cwoe_5052         CDS       T01153                                 

Definition
(GenBank) glycosyl transferase family 2
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_4 ANAPC3 TPR_14 TPR_16 TPR_7 TPR_2 TPR_6
Motif
Other DBs
NCBI-ProteinID: ADB53463
UniProt: D3FD71
Position
complement(5386334..5389027)
Genome map
AA seq 897 aa AA seqDB search
MTEAGQTVCLNMIVKDEAAVIARCLASVRPFVDCWTIVDTGSTDATRELVREQLADLPGE
LHERPWVDFGHNRSEALALARGRADYVLVIDADETLEPAPGFVLPPLTADAYDLEVRYDG
VSYLRRQLLRDGLEWAYHGVLHEHVHCDAAETVAPLPGLVTRVRHDGARSRDPLTYRRDA
LVLERALLDEPENTRYAFYLAQSHRDGGQLERAIEAYERRIELGGWSEETWFSRYQIALL
QERLERPWPEVQQAYLAAFAAAPDRAEPLFRIGLHHQVQREHAVAQLFFAHAMTLPPPAL
DRLFVERPLYDYLLPIEYAVAAYWIGDHATAIRTNNALLRSGQVPPEAIGRIVRNRRYSL
DARHPEQTGATVGAVHVVLVARDPGPELDDAVESVLGQDDGACDVVVIDDGSRSPLGEHL
PGDPRVRLIRRGEHEAAGRDAALGAFVAGDCAPDDVVLELPVGESLADRNVVAAVTAAFA
DPGCRLVYGPRRRLDGRLAAGEPVTDAAAFATDGAAARDGAMLCFRASLWTDAAAADGAV
SDADVLWRAAGFDGTRFLDTALTRELAPPVPQATPLAATPLAATAPPATALPATALPATA
LPATALPATALPATALPASPPSRTHPEPNAAPAAAPPPQPSVSCLMVSRDRLGLARLAMR
CFADQTHADRELVIVSEAGAGYRRALQRSAEQLELDNVRIVAAEAGTPLGALRNLSVDAA
DGDVLCQWDDDDLSHPLRVTTQLDGMLRAGARACFLTDHLQFLEREGLVYWIDWTLGGRA
TEEMQLFPGTVMLWKDARFRYPESGPYASRGEDSVLVNQLFRSVPIARLPGMGHMYLYRY
HGRNTFSEEHHMRITSCASPVAAVLPHAERIREALAYYPVPKPVAVFGQDGPALAVS
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggccggccagacggtctgtctcaacatgatcgtcaaggacgaggcggcggtg
atcgctcgctgcctcgcctccgtgcgtccgttcgtcgactgctggacgatcgtcgacacc
ggctcgaccgacgcgacgcgcgagctggtgcgcgaacagctcgccgaccttcccggcgag
ctgcacgagcgcccgtgggtcgacttcggccacaaccgcagcgaggcgctcgcgctcgcg
cgcggccgcgccgactacgtgctcgtgatcgacgccgacgagacgctcgagcccgcgccg
ggcttcgtcctcccgccgctgaccgccgacgcgtacgacctcgaggtccgctacgacggt
gtctcgtacctgcgccgccagctgctgcgcgacgggctggagtgggcctaccacggggtc
ctgcacgagcacgtccactgcgacgcggcggagaccgtcgcaccgctgccgggcctcgtc
acgcgcgtgcggcacgacggggcgcgctcgcgcgacccgctcacctatcggcgcgacgcg
ctcgtgctcgaacgcgcgctgctcgacgagcccgagaacacgcgctacgccttctacctc
gcgcagagccatcgcgacggcggccagctcgaacgcgcgatcgaggcgtacgagcggcgg
atcgagctgggcggctggagcgaggagacgtggttctcccgctaccagatcgccctgctc
caggaacggctcgaacggccgtggccggaggtccagcaggcgtacctcgccgcgttcgcc
gccgcgccggaccgcgccgagccgctcttccgcatcggcctgcaccaccaggtgcagcgc
gagcacgcggtcgcgcagctgttcttcgcgcacgcgatgacgctcccgccgccggcgctc
gaccgcctcttcgtcgagcggccgctgtacgactacctgctgccgatcgagtacgccgtc
gccgcctactggatcggcgaccacgcgaccgcgatccgcacgaacaacgcgctgctgcgc
tcggggcaggtgccgccggaggcgatcggccggatcgtgcgcaaccgccgctacagcctc
gacgcgcgccaccccgagcagaccggcgcgaccgtcggcgccgtgcatgtcgtgctcgtc
gcgcgggatcccggccccgagctggacgacgcggtcgagagcgtcctgggccaggacgac
ggcgcgtgcgacgtcgtcgtgatcgacgacggctcgcgcagcccgctcggcgagcacctg
cccggcgatccgcgtgtgcggctgatccgccgcggcgagcacgaggcggccgggcgcgac
gccgcgctcggcgcgttcgtcgccggcgactgcgcgccggacgacgtcgtgctggagctt
ccggtcggggagagcctggcggaccggaatgtcgtcgcggcggtgacggcggcgttcgcc
gatcccggctgccgcctggtgtacggcccgcgccggcggctcgacgggcgcctggcggcc
ggcgagccggtcaccgacgcggccgccttcgcgaccgacggcgcggcggcgcgcgatggc
gcgatgctctgcttccgcgcgtcgctgtggacggatgccgcggccgccgacggcgccgtg
tcggacgccgacgtgctctggcgcgcggccggcttcgacggcacccgcttcctcgacacg
gcgctgacgcgagagcttgcgccgcccgtgccgcaggcgacgccgctcgccgcgacgccg
ctcgccgcgaccgcgccgcccgcgaccgcgctgcccgcgaccgcgctgcccgcgaccgcg
ctgcccgcgaccgcgctgcccgcgaccgcgctgcccgcgaccgcgctgcccgcgtctccg
ccctcccgcacgcacccggagccgaacgccgctccggccgccgcgccgccgccgcagccg
tccgtcagctgcctgatggtcagccgcgaccgcctcggcctcgcgcgcctggcgatgcgc
tgcttcgccgaccagacgcacgccgaccgcgagctggtgatcgtctccgaggccggcgcc
ggctaccggcgcgcgctccagcgctcagccgagcagctggagctcgacaacgtgcggatc
gtcgccgccgaggcgggcacgccgctcggcgcgctgcgcaacctgtcggtcgacgccgcc
gacggcgacgtgctgtgccagtgggacgacgacgacctcagccatccgctgcgcgtcacg
acgcagctcgacggcatgctgcgcgccggcgcgcgcgcctgctttctcaccgaccacctg
cagttcctcgaacgcgaggggctcgtgtactggatcgactggacgctcggcgggcgcgcg
accgaggagatgcagctgttcccgggcacggtgatgctgtggaaggacgcccgcttccgc
tatcccgagagcggcccgtacgcgagccgcggcgaggactccgtgctcgtcaaccagctg
ttccgcagcgtgccgatcgcgcgactgcccgggatgggccacatgtacctctaccgctac
cacgggcgcaacacgttctccgaggagcaccacatgcggataacgagctgcgcctcgccg
gtcgccgcggtgctgccgcacgccgagcggatccgcgaggcgctcgcctactacccggtc
ccgaaaccggtcgccgtcttcggccaggacggcccggcgctcgccgtcagctga

DBGET integrated database retrieval system