KEGG   Conexibacter woesei: Cwoe_5070Help
Entry
Cwoe_5070         CDS       T01153                                 

Definition
(GenBank) Mandelate racemase/muconate lactonizing protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: ADB53479
UniProt: D3FD87
Position
complement(5418080..5419213)
Genome map
AA seq 377 aa AA seqDB search
MEHVIARIEAFPLVYAEPHYRGAERCVTLVRIETADGVVGWGEAISQVPAATRATRTLVH
DAFAPLLLGGDATNVEAHWHAMCRHAYWFGVEGIAAFAISAIDMALWDLKGKLLGQQVVT
LLGGRLKDEIPAMGSIIFDMDDLDWTLAEFAWMREQGYRIVKAGWGMTLDSVFGEDRTRD
LRYLTEVRAVIGDELSLVVDVPGAQRVWDLATAQRRLREWERFDLRWVEQPLHPADLDHH
RRLRAATTTPVGTGEDEWSPETYRHVLSCGGVDVVQLDPGRCLGLTGCREVVRMVEAAGL
RYSMHSWSSALNTAASLHVLALSEHGDTLDFKPHESPMQHDVIEDPWVQRDGLLALRAAP
GLGVTVDERALDRFALR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgtgatcgcgaggatcgaggcgtttccgctcgtctacgccgagccgcactac
cgcggcgcggagcgctgcgtcacgctcgtgcggatcgagacggcggacggcgtggtcggc
tggggcgaggcgatctcgcaggtgcccgcggcgacgcgcgcgacgcggacgctcgtgcac
gacgcgttcgcgccgctgctgctcggcggcgacgcgacgaacgtcgaggcgcactggcac
gcgatgtgtcggcacgcctactggttcggcgtcgaggggatcgccgcgttcgcgatcagc
gcgatcgacatggcgctgtgggacctcaagggaaagctgctcggccagcaggtcgtgacg
ctgctcggcgggcggctcaaggacgagatcccggcgatggggtcgatcatcttcgacatg
gacgacctcgactggacgctggccgagttcgcctggatgcgcgagcaggggtaccggatc
gtcaaggccggctgggggatgacgctcgactccgtcttcggggaggaccgcacgcgcgac
ctgcgctacctgaccgaggtgcgcgcggtcatcggcgacgagctgtcgctcgtcgtcgac
gtgccgggcgcgcagcgcgtctgggacctcgcgacggcacagcggcggctgcgcgagtgg
gagcggttcgacctgcgctgggtcgagcagccgctgcacccggccgacctcgaccaccac
cgccgcctgcgcgcggcgacgacgacgccagtcggcaccggcgaggacgagtggagcccg
gagacctaccgtcacgtgctctcctgcggcggcgtcgacgtcgtgcagctggacccgggg
cgctgcctcgggctgaccggctgccgcgaggtggtgcggatggtcgaggcggcggggctc
agatacagcatgcacagctggagcagcgcgctgaacacggcggccagcctgcacgtgctg
gcgctctccgagcacggcgacacgctcgacttcaagccgcacgagtcgccgatgcagcac
gacgtgatcgaggatccgtgggtgcagcgcgacgggctgctggcgttgcgagcggcgccc
ggactcggcgtcacggtcgacgagcgggcgctcgaccgcttcgctctgagatag

DBGET integrated database retrieval system