KEGG   Conexibacter woesei: Cwoe_5073Help
Entry
Cwoe_5073         CDS       T01153                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-ProteinID: ADB53482
UniProt: D3FD90
Position
5421267..5422424
Genome map
AA seq 385 aa AA seqDB search
MDFTISDDLADIRQAVRQLCERFDGEYWRALEPDRYPDEFVRALTEHGWLAALIPEQYGG
AGLPLSAASVILEEICASGCNAGACHAQMYVMGTVLRHGSDEQKARWLPEIAAGRLRLQA
FGVTEPGAGSDTTKIQTRARRDGDGWVVDGQKIWTSRAEHSDLMVLLARTTPIDQIEKKT
DGLSVFLVDMRERGDELTIRPIKTMMNHATTEVFLDGLRLPADALVGEQDRGFRYILDGM
NAERILIAGECIGDGRFLTEKAVGYASERTVFGRPIGANQGVQFPIARAHMALEAANLMR
WKAVWLYEQGKPCGAEANMAKFLASEASWAAANASVDAHGGFGFAEEYDVERKFRETRLY
SVAPISNNLVQAYVGQHVLGLPRSY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggacttcacgatctcggacgacctcgctgacatccgccaggcggtccgccagctgtgc
gagcgcttcgacggcgagtactggcgcgcgctggagcccgaccgctaccccgacgagttc
gtgcgcgcgctgaccgagcacggctggctcgccgcgctgatccccgagcagtacggcggc
gccggcctgccgctgtcggccgcgagcgtgatcctcgaggagatctgcgccagcggctgc
aacgccggcgcgtgccacgcgcagatgtacgtgatggggaccgtcctgcgccacggcagc
gatgagcagaaggcgcgctggctgcccgagatcgccgccggcaggctgcgcctgcaggcg
ttcggcgtgaccgagcccggcgccggctccgacacgacgaagatccagacgcgcgcgcgg
cgcgacggcgacggctgggtcgtcgacggccagaagatctggacctcgcgcgcggagcac
tccgacctgatggtgctgctcgcgcgcacgaccccgatcgaccagatcgagaagaagacc
gacggcctctcggtcttcctcgtcgacatgcgcgagcgcggcgacgagctgacgatcaga
ccgatcaagacgatgatgaaccacgccacgaccgaggtcttcctcgacggtctgcggctg
ccggcggacgcgctcgtcggggagcaggacagaggctttcgctacatcctcgacggcatg
aacgccgagcggatcctgatcgccggcgagtgcatcggcgacggccgcttcctgaccgag
aaggcggtcggctacgcgagcgagcggaccgtcttcgggcgcccgatcggcgccaaccag
ggcgtccagttcccgatcgcccgcgcgcacatggcgctggaggcggcgaacctgatgcgc
tggaaggccgtctggctctacgagcagggcaagccgtgcggcgcggaggcgaacatggcg
aagttcctcgcctcggaggcgtcgtgggcggccgcgaacgccagcgtcgacgcgcacggc
ggcttcggcttcgcggaggagtacgacgtcgagcgcaagttccgcgagacgcgcctctac
tcggtcgcgccgatctccaacaacctcgtccaggcgtacgtcgggcagcacgtgctcggc
ctgccgcggtcctactga

DBGET integrated database retrieval system