KEGG   Conexibacter woesei: Cwoe_5076Help
Entry
Cwoe_5076         CDS       T01153                                 

Definition
glycoside hydrolase family 42 domain protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cwo  Conexibacter woesei
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cwoe_5076
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cwoe_5076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5424440..5426581)
Genome map
AA seq 713 aa AA seqDB search
MILATQYHRPPFPRRDRWRDDLARIRATGFDTIVLTAPWAWIEPEPGAYDFADQDELVAL
AGEIGLKVVINLWTELQPVWIERELPDARLVDHTGRPVVSSPLAYAQFGVMPGGCTDHPG
VRERASAFMTATAERFAGAENLLLWDCWNEIRWMTQADGHVCHCEHTVARFRDWLRERHG
DLDGLNAAWQRRYRSWDDVAMAKLPTRTYTDVMAYQAFLTRRAAVDLRWRRDAVHAGDSS
RPILAHTAFPSAFSSGEWFEYEPALARGNDFELADQVDGLGSSHFPAFIHTSAVEYATRL
EASRSSAGGFNWIAELQGGAAGHGLQPMRAVPGRLQARWVWNGIARGAKAVSFWCWRDEV
FGREAAGFGIVGDDGHRDERLAELRRTADLLEAHGPLLDAYAPAPARVGVVLEPSAYQLD
WAGSGRTGGLKVGAGSGYQAAHDLQGHLLALERLQIPYDVVDPSHAHDLSGYALLVMPWP
LVVDPAFGERVLAWTRAGGTLLTGAELDAFDAAGLYRYQDERPFANALGLRGSGLRQPDG
RALEYELDGTRGELRTATWVVPQDAAVSAGADVLAADERGATVVRRAVGDGHVVAVGTNA
GLAYFEQRDAGFERFLRTLAEGAGALAPLRCSIEDGERVQWRHGAAGEHGELLFVINEGA
AADVTFDWPADRLPAAAAHDLTSGTELELARDGERLTLRLPLREEGYHVVRLT
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctcgcgacgcagtaccaccgcccgccgttcccgcgccgcgaccgctggcgcgac
gacctcgcgcggatccgcgcgaccggcttcgacacgatcgtgctgaccgcgccgtgggcg
tggatcgagccggagccgggcgcgtacgacttcgccgaccaggacgagctggtcgcgctc
gcgggcgagatcgggctgaaggtcgtgatcaacctctggaccgagctgcagccggtctgg
atcgagcgcgagctgcccgacgcccggctcgtcgaccacaccggccggccggtcgtctcc
tcgccgctcgcctacgcgcagttcggcgtgatgcccggcggctgcaccgaccacccgggc
gtgcgcgagcgcgcgagtgcgttcatgaccgcgacggcggagcgcttcgccggcgccgag
aacctgctgctgtgggactgctggaacgagatccgctggatgacgcaggccgacgggcac
gtctgccactgcgagcacaccgtcgcgcgcttccgcgactggctgcgcgagcgccacggc
gacctcgacggcctcaacgccgcctggcagcgccgctaccgctcgtgggacgacgttgcg
atggcgaagctgccgacgcgcacctacaccgacgtgatggcctaccaggcgttcctgacg
cgccgcgccgcggtcgacctgcgctggcgtcgcgacgcggtccacgccggcgactcttcg
cgcccgatcctcgcgcacacggcgttcccgtcggcgttctccagcggcgaatggttcgag
tacgagccggcgctcgcgcgcggcaacgacttcgagctggccgaccaggtcgacgggctc
ggctcctcgcacttcccggcgttcatccacacgagcgcggtcgagtacgcgacgcggctg
gaggcgagccgcagctcggccggcggcttcaactggatcgccgagctgcagggcggcgcg
gccggccacggcctgcagccgatgcgagcggtccccggccgtctgcaggcgcgctgggtc
tggaacgggatcgcgcgcggcgccaaggcggtcagcttctggtgctggcgcgacgaggtc
ttcgggcgcgaggcggccggcttcgggatcgtcggcgacgacggccaccgcgacgagcgg
ctcgccgagctgcgcagaacggcggacctgctggaggcgcacggtccgctgctcgacgcg
tacgcgcccgcgcccgcgcgcgtgggggtcgtgctcgaaccgagcgcgtaccagctcgac
tgggccggctccggcagaacgggcgggttgaaggtcggggccggcagcggctaccaggcc
gcccacgacctccagggccatctgctcgcgctggagcggctgcagatcccctacgacgtc
gtcgacccgtcgcacgcgcacgacctgtccggctacgcgctgctggtgatgccatggccg
ctcgtcgtcgaccccgccttcggcgagcgtgtgctcgcctggacgcgcgccggcggcacg
ctgctgacgggggcggagctggacgcgttcgacgccgccggtctctaccgctaccaggac
gagcgcccgttcgcgaacgcgctcggcctgcgcggcagcgggctgcgtcagccggacggc
cgcgcgctcgagtacgagctggacgggacgcgcggcgagctgcgcaccgcgacctgggtc
gtgccgcaggatgccgcggtgagcgccggcgcggacgtgctcgcggccgacgagcgcggc
gcgacggtcgtgcgccgcgcggtcggcgacgggcacgtcgtggcggtcggcaccaacgcc
gggctcgcctacttcgagcagcgcgacgccggcttcgaacggttcctgcggacgctcgcg
gagggcgccggcgcgctggcgccgctgcgctgctcgatcgaggacggcgagcgggtgcag
tggcgccacggcgccgcgggcgagcacggcgagctgctgttcgtgatcaacgagggcgcg
gcggccgacgtcacgttcgactggccggcggatcggctgccggccgcggcggcgcacgac
ctgacgagcgggacggagcttgagctggcgcgcgacggcgagcggctgacgctgcgcctg
ccgctgcgggaagagggctaccacgtggtccggctcacctag

DBGET integrated database retrieval system