KEGG   Conexibacter woesei: Cwoe_5080Help
Entry
Cwoe_5080         CDS       T01153                                 

Definition
(GenBank) Pyruvate dehydrogenase (acetyl-transferring)
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
cwo  Conexibacter woesei
Pathway
cwo00010  Glycolysis / Gluconeogenesis
cwo00020  Citrate cycle (TCA cycle)
cwo00620  Pyruvate metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Module
cwo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_5080
   00020 Citrate cycle (TCA cycle)
    Cwoe_5080
   00620 Pyruvate metabolism
    Cwoe_5080
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cwoe_5080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ADB53489
UniProt: D3FD97
Position
complement(5429776..5430765)
Genome map
AA seq 329 aa AA seqDB search
MAVRQQTRRADTAERDLHLELFRSMTRIRRFEELIQSLFLKGEVYGTTHLYSGQEAVAVG
VSSALDTRDRVAGTYRGHGHAMAQGVGASELLDEMLGRATGINGGRAGSMNVTSMKHGYM
GSYGIVGGSIAAAVGAALATRLDGGVAVAYFGDGATNQGYFFECLNFAHVFRLPVLFVCE
NNLYMEYTLTEAVSGGDILSRAASLGVEAEQVDGMQVWSVREAAQRAVARGRAGEGPTLL
EARTYRFVGHSRSDPARYRPDGELEQWRERDPLVLSRARLAEEGVAADVLDAVDTDVAAE
LEAARESGLAAPWPDPATLPPQFAEELRA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaggcagcagaccagacgagcggacacggccgagcgggatctccatctcgag
ctgttccgctcgatgacacggatccggcggttcgaggagttgatccagtcgctcttcctg
aagggggaggtgtacgggacgacgcatctgtacagcggccaggaggcagtggcggtcggc
gtgtcgagcgcgctcgacacgcgcgaccgcgtcgccggcacctaccgcggccacggccat
gcgatggcgcagggcgtcggcgcgagcgagctgctggacgagatgctcggccgcgcgacc
gggatcaacggcggtcgcgccggctcgatgaacgtgacgtcgatgaagcacggctacatg
ggcagctacgggatcgtcggcggctcgatcgcggcggcggtcggcgcggcgctggcgacg
cggctcgacggcggcgtggcggtcgcctacttcggcgacggcgcgacgaaccagggctac
ttcttcgagtgcctcaacttcgcgcacgtgttcaggctgccggtgctgttcgtctgcgag
aacaacctgtacatggagtacacgctgaccgaggcggtcagcggcggcgacatcctgagc
cgcgcggcgtcgctcggcgtggaggccgagcaggtcgacgggatgcaggtgtggagcgtg
cgtgaggcggcgcagcgtgcggtcgcgcgcggccgtgccggcgagggcccgacgctgctg
gaggcgcggacgtatcgcttcgtcggccattcgcgcagcgatccggcgcgctaccggccc
gacggcgagctggagcagtggagagagcgcgacccgctcgtgctctcacgtgcgcggctc
gcggaggagggcgtcgcggcggatgtgctcgacgcggtcgataccgacgtcgcggcggag
ctggaggccgcgcgcgagtccgggctggcggcgccgtggccggacccggcgacgctcccg
ccgcagttcgccgaggagctgcgcgcatga

DBGET integrated database retrieval system