KEGG   Conexibacter woesei: Cwoe_5089Help
Entry
Cwoe_5089         CDS       T01153                                 

Definition
(GenBank) Parallel beta-helix repeat protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_helix NosD
Motif
Other DBs
NCBI-ProteinID: ADB53498
UniProt: D3FDA6
Position
complement(5440247..5442622)
Genome map
AA seq 791 aa AA seqDB search
MRPVNSCRRSVLVLATAVTCAASGGTALAANGDGPGERDGRVQHKRSSWSVAPDGRGQAC
TRWRPCQLETAREQVRAAAPAMSGDLRVELAGGTYELSSTFVLGAADSGRNGHDVVYAAA
PGAEPVLSGGRTVRNWRLVDPAKRIWRADVGALDTRQLYAEGVRVRRAVHVPGLPGEVNR
TATGFRTTSTAPQSWAAPTDVELVWRSRDAGIFDWSEARCRVTGISGDASGTDVRLAQPC
FDNSVAVFASDVAGGREKLRAPSWSENSPSFLADETRPGRWTIERGRHGNAIHYAARPGE
DPRRRSFVAATGETLVRIGGTVAEPAHDIVVRGLRLSETTWLGPDSGYGYPNIIGNAYAI
APDALDPGNFNRGEAYPPGALELDKAHDVRVEGNRLERLGGIGVRIQSTARATIDGNVVR
DVSAGAILIGRNGPLLEGDAVDNTISNNVLDTIGAEYGSSSGIYLNIPIRTTMRNNLITN
TAYSGVTLGGTWHDIGATEGNGILDNHVANVLRRGNDGGGIYSVYRQGTSYENGLLVEGN
VVRDTRRDAIGFGLYSDIGSDFTTSRGNVSTGFAFGGGGCALPYLNEIRSTGNWLHGQYG
RYGFPDIYWVCDGPVTNVEVDNHRLAEPDPAADCAARAACAEIVAGAGLEPGYERLLTGG
YSFDDVPTFEDLRDDSFLVDSVHAGLDFGRGQWVAAYGTPGYATASHARFSSGDAGPRTI
TPLRGVGLSSLVLEGPGTYTISDGTTTRSGRLRGAGRPLQVRTGFRSPGATVSLTFSDGQ
QVVVDDLRIAR
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccggtgaattcatgtcggaggagcgtcctcgtcctcgcgaccgcggtgacctgc
gcggcgagcggcgggaccgcgctcgcggcgaacggcgacggccccggcgaacgcgacggc
cgtgtccagcacaagcgcagcagctggagcgtggcgccggacgggcgcgggcaggcgtgc
acgcgctggcgcccgtgtcagctggagacggcgcgcgagcaggtccgcgccgccgctccc
gcgatgagcggcgacctgcgcgtcgagctggccggcgggacctacgagctgtcgagcacc
ttcgtgctcggcgccgccgactccggtcgcaacggccacgacgtcgtctacgcggcggcg
cccggcgccgagcccgtgctgtccggcggtcgcacggtacgcaactggagactcgtcgac
ccggccaagcggatctggcgcgccgacgtcggcgcgctcgacacgcgccagctctacgcc
gaaggcgtgcgcgtgcggcgcgccgtccacgttccggggctgccgggcgaggtcaatcgc
accgcgaccggcttccgcacgacgagcaccgcgccgcagtcgtgggcggcgccgaccgac
gtcgagctggtctggcgcagcagagacgcaggcatcttcgactggtcggaggcgcgctgc
cgcgtcaccggcatcagcggcgacgcctcggggacggacgtcagactcgcgcagccgtgc
ttcgacaattccgtcgcggtcttcgcgtcggacgtcgcgggcggcagagagaagctgaga
gcgccgagctggagcgagaacagcccgagcttcctcgccgacgagacgcggcccggccgc
tggacgatcgagcgcggcagacacggcaacgcgatccactacgcggcccgccccggcgag
gacccgcgtcgtcgcagcttcgtcgcggcgaccggcgagacgctcgtcaggatcggcggc
accgtcgccgagccggcgcacgacatcgtcgtccgcggcctgcggctgtcggagacgacc
tggctcggtccggacagcggctacggctaccccaacatcatcggcaacgcctacgcgatc
gcgccggacgcgctcgatcccggcaacttcaacagaggcgaggcgtacccgcccggcgcg
ctggagctggacaaggcgcacgacgtgcgggtcgagggcaaccgcctggagcggctcggc
ggcatcggcgtgcggatccagagcaccgcccgcgcgacgatcgacggcaacgtcgtgcgc
gacgtctccgccggcgcgatcctgatcggccgcaacggcccgctgctggagggcgacgcc
gtcgacaacacgatctcgaacaacgtgctcgacacgatcggcgccgagtacggcagctcg
tcagggatctacctgaacatcccgatccgcacgacgatgcggaacaacctgatcacgaac
accgcctacagcggtgtcactctcggcggcacctggcacgacatcggcgcgaccgagggc
aacgggatcctcgacaaccacgtcgcgaacgtgctgcggcgcggcaatgacggcggcggc
atctacagcgtctacagacagggcacgtcgtacgagaacggcctgctggtcgagggcaac
gtcgtgcgcgacacgcgccgcgacgcgatcggcttcggcctctactccgacatcggcagc
gacttcacgacgagccgcggcaacgtctcgaccgggttcgcgttcggaggcggcggctgc
gcgctgccgtacctgaacgagatcagaagcaccggcaactggctgcacgggcagtatggg
agatacgggttcccggacatctactgggtctgcgacgggccggtcacgaacgtcgaggtc
gacaaccacagactcgccgagcccgacccggcggccgactgcgcggcgagagcggcatgc
gcggagatcgtcgcgggcgcggggctcgagcccggctacgagcgcctcctgacgggcggc
tactcgttcgacgacgtgccgacgttcgaggacctcagagacgactcgttcctcgtcgac
agcgtccacgccgggctcgacttcggccgcggacagtgggtcgcggcgtacggcacgccc
ggctacgcgaccgcgtcgcacgctcgcttctccagcggcgacgccgggccgcggacgatc
acgccgctgagaggcgtcgggctctcctcgctcgtgctcgaaggccccggcacgtacacg
atcagcgacggcaccacgacccgcagcggcaggctgcgcggcgccggccgcccgctgcag
gtgcggaccggcttcagatccccgggagcgacggtctcgctcaccttcagcgacggccag
caggtcgtcgtcgacgacctgcgcatcgcgcgctag

DBGET integrated database retrieval system