KEGG   Conexibacter woesei: Cwoe_5096Help
Entry
Cwoe_5096         CDS       T01153                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02025  multiple sugar transport system permease protein
Organism
cwo  Conexibacter woesei
Module
cwo_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Cwoe_5096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF3149
Motif
Other DBs
NCBI-ProteinID: ADB53505
UniProt: D3FDB3
Position
complement(5450961..5451833)
Genome map
AA seq 290 aa AA seqDB search
MRARREQLLPWGFLLPSAAILGLITLYPLLYAIVLSFKQGSFIEVGGFAGIDNYSGLFED
GSLFPGALRFSAIFTVLTVAGSYALGLGFALAVHRVRRGRWLLRMGLLTPWVVPPVVAVI
AWRWMVNDDGSLVNQALGVVGIDPVAFLSDPFWASVMVILLRIWRTFPFVFLTLFAARQG
VSDELYEAAALDGSTGFSAFRRITLPQLAPVSIVSSLLVAIWSFNDFESIFLLTRGGPSN
ATYNLVVLGYYEAFFGNDVGLAAAMGVVALVLLLVLSVVLLRLLRRVNET
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgagggcgcgccgcgagcagctgctgccgtggggcttcctgctcccgtcggcggcgatc
ctcggcctgatcacgctgtacccgctgctgtacgcgatcgtcctgagcttcaagcagggc
tcgttcatcgaggtcggcgggttcgccgggatcgacaactacagcggcctgttcgaggac
gggtcgctgtttcccggcgcgctgcgcttcagcgcgatcttcaccgtgctgacggtcgcg
ggctcctacgcgctcgggctcggcttcgcgctcgccgtgcaccgcgtcagacgcggccgt
tggctgctgcggatgggcctgctgacgccgtgggtcgtgccgccggtcgtcgcggtgatc
gcctggcgctggatggtcaacgacgacggcagcctcgtcaaccaggcgctcggcgtggtc
gggatcgatccggtcgcgtttctgtcggacccgttctgggcgagcgtgatggtgatcctg
ctgcggatctggcggacgttcccgttcgtcttcctgacgctgttcgcggcgcgccagggc
gtctcggacgagctgtacgaggcggcggcgctcgacggctcgaccggcttctcggcgttc
cggcggatcacgctgccgcagctcgcgccggtctcgatcgtgagcagcctgctcgtcgcg
atctggtcgttcaacgacttcgagtcgatcttcctgctgacgagaggcggaccctccaat
gcgacgtacaacctcgtcgtgctcggctactacgaggcgttcttcggcaacgacgtcggc
ctcgcggccgcgatgggcgtcgtcgcgctcgtgctgctgctcgtcctcagcgtggtgctg
ctgcggctgctgcggcgggtgaacgagacatga

DBGET integrated database retrieval system