KEGG   Conexibacter woesei: Cwoe_5098Help
Entry
Cwoe_5098         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_helix NosD
Motif
Other DBs
NCBI-ProteinID: ADB53507
UniProt: D3FDB5
Position
complement(5453179..5455545)
Genome map
AA seq 788 aa AA seqDB search
MSALNSWRRSVLLAAIAATCAASGETAYAAGDAPAGDGHGPHQRSTWNVAPDGRGQSCMR
WRPCRLETAREQVRAAAPAMTRDLRVELAGGRYELSSTFVLGAADSGRNGHDVVYAAAPG
AEPVLTGGREVRGWRLVDPARRIWRAAVGRLDTRQLYADDVRLRRAVHVPGLPGDVRRTA
TGLHTTSAEPRTWAAPTDVEMVWRARGAGAFEWVEARCRVTGMSADAAGTGTDVSIAQPC
LDNAVGIYASNVAGGGEVLGAPSWSENSSTFLADDTRPARWAIERTAAGNAMHYRARPGE
DPRRRRFVAATGETLVRIGGTVAEPAHDIVVRGLRFSESTWLGPDTGMGFPNLFANAYAI
RPDALSPETYRGEAFPPGALELDKTHDVRVEGNRFERLGAIGVRIQSTSRATVDGNVLRD
LSAGGVLIGRLGPDLEGEVEDNVISNNAIDGVGAEYGASPGVFLNVPRRTTLRNNFISNT
GYSGVTMRGSWNGSGTTEGNRYVDNYVANVLRRASDGGGIYTVYPQGTSWDNGLLVAGNV
VRDMRPGALGFGLYNDIGSDYSTSRDNVSYNFLIAGGGCAQPYLNEIRSTGNWLRGRLPG
VPDVWWVCDGPVTNVEVDNHSLDAADPAADCAARPACAAIVANAGLQAGYEDRLTGTYSF
DDVPTFEDVNADSFDVDSVHAGLDFGWGQWIAAYGTPGYATTSHARFATADAGPRTIAPV
RGVVLSSLVLEGSGTYTISDGTSTRSGTLRGPGRPVRVQTGFRTTGAKVSLTFSDGQQVV
VDDLRVSR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttgaattcatggcggcggagcgtgctgctcgccgcgatcgctgcgacctgc
gcggcgagcggcgagaccgcgtacgccgccggcgacgcgccggccggcgacggccatggc
ccgcaccagcgcagcacctggaacgtggcgccggacgggcgcgggcagtcgtgcatgcgt
tggcgtccgtgccggctggagacggcccgcgagcaggtgcgcgccgccgccccggcgatg
acgcgcgacctgcgcgtcgagctggccggcggacgctacgagctgtcgagcacgttcgtc
cttggcgcggccgattcgggtcgcaacggccatgacgtcgtctacgcggcggcgccgggc
gccgagccggtcctgacgggtggccgcgaggtgcgcggctggagactggtcgacccggcg
aggcggatctggcgagcggcggtcggccggctcgacacgcgtcagctctacgccgacgac
gtccgcctgcggcgcgcggtccacgtcccggggctgcccggcgacgtgagacgcaccgcg
accgggctgcacacgacgagcgccgagccgcgcacgtgggctgccccgaccgacgtcgag
atggtctggcgggcgagaggcgcgggcgccttcgagtgggtcgaggcgcgctgccgcgtg
accggcatgagcgccgacgcggccggcacggggaccgacgtcagcatcgcgcagccgtgc
ctcgacaacgcggtcgggatctacgcctccaacgtcgccggcggcggcgaggtgctcggc
gccccgagctggagcgagaacagctccacgttcctggccgacgacacgcggcctgcccgc
tgggcgatcgaacgcacggcagcgggcaacgcgatgcactatcgcgcgcggccgggcgag
gatccgcgtcgtcgccgcttcgtcgcggcgaccggggagacgctcgtgcggatcggcgga
acggtcgccgagccggcgcacgacatcgtcgtgcgcgggctgcgcttctcggagtcgacc
tggctcggaccggacaccggcatgggcttcccgaacctgttcgcgaacgcctacgcgatc
agacccgacgcgctcagccccgagacctaccgcggcgaggcattcccgccgggcgcgctg
gagctggacaagacgcacgacgtccgcgtcgagggcaaccgcttcgagcggctcggcgcg
atcggcgtgcggatccagagcacgagtcgcgcgacggtcgacggcaacgtgctgcgcgac
ctgtccgccggcggcgtcctgatcggccggctcgggcccgacctcgagggcgaggtcgag
gacaacgtgatctcgaacaatgcgatcgacggcgtcggcgccgagtacggcgcctcgcct
ggcgtcttcctcaacgtcccgcgccgcacgacgctgcgcaacaacttcatctcgaacacc
ggctacagcggcgtgacgatgcgcggctcgtggaacggctcgggcacgaccgaaggcaac
agatacgtcgacaactacgtcgccaacgtgctgcggcgcgccagcgacggcggcggcatc
tacaccgtctacccgcagggcacgtcgtgggacaacgggctgctggtggccggcaacgtc
gtgcgcgacatgcgccccggggcgctcggcttcgggctctacaacgacatcggcagcgac
tactcgaccagccgcgacaacgtctcctacaacttcctgatagccggcggcggctgcgcg
cagccgtacctgaacgagatcagaagcaccggcaactggctgcgcgggagacttcccggc
gtgccggacgtgtggtgggtctgcgacgggccggtcacgaacgtcgaggtcgacaaccac
agcctcgacgcggccgatccggcggcggactgtgcggcgagaccggcgtgcgcggcgatc
gtcgcgaacgcggggctccaggccggctacgaggaccgcctgaccgggacctactcgttc
gacgacgtgccgacgttcgaggacgtcaacgccgactcgttcgacgtcgacagcgtccac
gccgggctcgacttcggctgggggcagtggatcgccgcctacggcacgccgggctatgcg
acgacgtcgcacgcccgcttcgcgaccgcggacgccgggccgcgcacgatcgcgccggtg
agaggcgtcgtgctctcgtcgctggtgctcgaaggctccggcacctacacgatcagcgac
ggcacgagcacccgcagcggcacgctgcgcgggccgggacgtccggtgcgcgtccagacc
ggcttcagaacgaccggggcgaaggtctcgctcacgttcagcgatggccagcaggtcgtc
gtcgacgacctgcgcgtctcgcgctga

DBGET integrated database retrieval system