KEGG   Conexibacter woesei: Cwoe_5109Help
Entry
Cwoe_5109         CDS       T01153                                 

Definition
(GenBank) oxidoreductase domain protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA Phage_TAC_11
Motif
Other DBs
NCBI-ProteinID: ADB53518
UniProt: D3FDC6
Position
complement(5464886..5465908)
Genome map
AA seq 340 aa AA seqDB search
MSDATEPVRVALVGAGDIGRAAHLPALLAHPAVELAAVVEPAAAARALLDVPGVPVIAEL
DAIADDEAIDAWVVATPPWVTPRLARHGLERGRFVLAEKPIATSVKAARAAFDGLAPALA
ARLQVGFTYRHDPAVERLAELIASGALGGPLQVRVVVYDELDDPADGEHAARLRATLAHG
LPVIHEGAHVADWLRVLLGPAQLDVEHAWSLRTLPDLPADNLCGASLRHPRGHRVQLEIG
WLLPAEVASEITIRGAGGCASIDIVTFALRVAGRAAVTDMVGTGDRTTRCFGRQLDRFVA
LCRGEPVAGPNGRSAIPTLADGIAALDLTERLARRMERTR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcgacggagccggtgcgcgtcgcgctggtcggtgcgggcgacatcgggcgg
gcggcgcatctgccggcgctgctcgcgcatcccgcggtcgagctggcggcggtcgtcgag
cccgccgccgccgcgcgtgcgctgctcgacgtccccggcgtccccgtcatcgccgagctt
gacgcgatcgccgacgacgaggcgatcgacgcgtgggtcgtcgcgacgccgccgtgggtg
accccgagacttgcccgtcacggtttggagcgcggccgcttcgtgctcgccgagaagccg
atcgcgacgagcgtcaaggccgcgcgggcggcgttcgacgggctcgcgcccgcgctcgcc
gcgcgcctgcaggtcggcttcacgtaccgccacgacccggcggtcgagcggctcgccgag
ctgatcgcgtccggcgcgctgggcgggccgctgcaggtgcgcgtcgtcgtctacgacgag
ctggacgaccccgctgacggcgagcacgccgcacgcctgcgcgcgacgctggcgcacggc
ctgccggtgatccacgagggcgcgcacgtggccgactggctgcgcgtgctgctcggcccg
gcgcagctcgacgtggagcacgcgtggtcgctgcgcacgctgccggacctgccggccgac
aacctctgcggcgcgagcctgcgccacccgcgcggccaccgcgtgcagctcgagatcggc
tggctgctgccggcggaggtcgcgagcgagatcaccatccgcggcgccggcggctgcgcg
tcgatcgacatcgtgacgttcgcgctgcgcgtcgccggccgtgcggccgtcaccgacatg
gtcgggaccggcgaccgcacgacgcgctgcttcggccgccagctcgaccgcttcgtcgcg
ctgtgccgcggcgagccggtcgccggacccaacggccgcagcgcgataccgacgctcgcc
gacgggatcgccgcgctcgacctgaccgaacgactggcacgacgaatggagaggacccga
tga

DBGET integrated database retrieval system