KEGG   Conexibacter woesei: Cwoe_5112Help
Entry
Cwoe_5112         CDS       T01153                                 

Definition
(GenBank) ABC transporter related protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_16 SMC_N AAA_21 AAA_22 SbcCD_C AAA_29 AAA_30
Motif
Other DBs
NCBI-ProteinID: ADB53521
UniProt: D3FDC9
Position
complement(5467740..5468594)
Genome map
AA seq 284 aa AA seqDB search
MTPNSEPAAAPAARPPLVQASGIVRRYDGAGGGVVAVDDVSLEIAAGTTVGLVGESGSGK
STFGRVVTGLEAADGGALRFDGADVTRLARGPARALSRERQMVFQDPVASLNPRQTVAQA
IEAPLAIHGVARDERRRRAAELLDLVQLGGRFAQRYPRSLSGGQCQRVGIARALALEPRL
VVLDEAVSALDVSVQAQVLNLLHELQERLGLTYLFISHDLGVVRYMAQEIVVLRHGRLVE
RGDRDTIFRAPRDAYTRELIAAVPTIHRDGATTPAARPTTTPGA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgaacagcgaaccggccgcggcgccggccgcgcgcccgccgctcgtgcaggcg
agcgggatcgtccgccgctacgacggcgccggaggtggcgtcgtagccgtcgacgacgtg
tcgctggagatcgccgccggcacgaccgtcggcctcgtcggcgagtcgggctcaggcaag
tcgacgttcggccgcgtcgtgacggggttggaggcggccgacggcggcgcgttgcgcttc
gacggcgccgacgtgacccggctcgcgcgcgggcctgcgcgggcgctgagccgcgagcgg
cagatggtcttccaggacccggtcgcctcgctgaacccgcggcagacggtggcgcaggcg
atcgaggcgccgctcgcgatccacggcgtcgcgcgcgacgaacgccgccgccgggcggcc
gagctgctcgacctcgtccagctcggcggccgcttcgcgcagcgctacccgcgctcgctc
tccggcgggcagtgccagcgcgtcgggatcgcgcgggcgctcgcgctggagccgcgcctg
gtggtgctcgacgaggccgtctcggcgctcgacgtctccgtccaggcgcaggtgctcaac
ctgctgcacgagctgcaggagcggctcgggctgacgtacctgttcatctcgcacgacctc
ggcgtcgtccgctacatggcgcaggagatcgtcgtgctgcggcacggcagactcgtcgag
cggggcgaccgcgacacgatattccgcgcccctcgcgacgcgtacacgcgcgagctgatc
gccgccgtcccgacgatccaccgcgacggcgcgacgacgccggccgcacgaccgaccacg
acccccggagcctga

DBGET integrated database retrieval system