KEGG   Conexibacter woesei: Cwoe_5117Help
Entry
Cwoe_5117         CDS       T01153                                 

Definition
(GenBank) ABC transporter related protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 AAA_21 SMC_N AAA_29 AAA_16 RsgA_GTPase SbcCD_C Sigma54_activat TniB AAA_5 AAA_33
Motif
Other DBs
NCBI-ProteinID: ADB53526
UniProt: D3FDD4
Position
complement(5473022..5473861)
Genome map
AA seq 279 aa AA seqDB search
MSAPLVEVEHLSRHYPIGRHDVHKAVDDVSLTIARGETFGLVGESGSGKSTLARLVLGLD
RPTAGSVRVAGHDLAELGGRALRAQRRHMQIVLQDPVAALNRRKTIGQIVGLPLAVHERI
GRDARAERVRELLALVGLPAAFAVRYPHELSGGQCQRVGIARAIALQPDLIVLDEAVSAV
DVSIQAQILNLLRDLQDRLGLTYLFVSHNLAVVRYMSSTVAVMQRGRIVETGTRERLFAR
PEHPYTRELLAAVPEPTPPDAPPADQRPTAVPAPERAPS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgctcgtcgaggtcgagcacctcagccgccactacccgatcggccggcac
gacgtccacaaggcggtcgacgacgtgtcgctgacgatcgcgcgcggggagacgttcggc
ctcgtcggcgagtccggcagcggcaagtcgacgctggcgcggctcgtgctcggcctcgac
cggccgacggcgggcagcgtgcgcgtggccggccacgacctcgccgagctcggcgggcgg
gcgctgcgcgcgcagcgccggcacatgcagatcgtgctgcaggacccggtcgcggcgctc
aaccgccgcaagacgatcgggcagatcgtcggcctgccgctggcggtccacgagcggatc
ggccgcgacgcgcgcgccgagcgcgtgcgcgagctgctcgcgctcgtcgggctgccggcg
gcgttcgccgtccgctacccgcacgagctgtccggcggccagtgccagcgcgtcggcatc
gcgcgggcgatcgcgttgcagcccgatctgatcgtgctcgacgaggccgtctccgcggtc
gacgtctcgatccaggcgcagatcctcaacctcctgcgcgacctgcaggaccgcctcggc
ctcacctacctgttcgtctcgcacaacctcgccgtcgtccgctacatgtcgagcaccgtc
gccgtgatgcagcgcggccgcatcgtcgagaccggcacgcgcgagcggctgttcgcgcgg
ccggagcacccctacacgcgcgagctgctcgccgccgtcccggagccgacgccgcccgac
gcgcccccagccgaccaacgcccaacggccgttcccgcaccagaaagagcaccatcatga

DBGET integrated database retrieval system