KEGG   Conexibacter woesei: Cwoe_5122Help
Entry
Cwoe_5122         CDS       T01153                                 

Definition
(GenBank) hypothetical protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4082
Motif
Other DBs
NCBI-ProteinID: ADB53531
UniProt: D3FDD9
Position
complement(5478358..5482074)
Genome map
AA seq 1238 aa AA seqDB search
MRFRLRRLMAVPLVAAAVLAVGSTAAWAVPPPCPSGTPTSFLQDSVGGDGNAVYGGYHLG
DSFVARGGSITQLTVWMKQAANAPVTLSVISGSSIGGTVVGTATIASGVSGKAVATLARP
IAVTLGATYILKVNAPAATRGLAELIPSATGEVYARDGSHGNTDYRASGWEMAMGVDFCG
AGIGGCTIGAPATVSQYASTGDGNAIFGGYYLGDSFVAGGSAITKLTVWMEQAADAPVTL
SVISGSAIGGTVVGTATLASGVSGKAEVALATPIAVRAGSTYILKVNAPAATRGTARLIA
TSGEVYARDGSHGNTDYRATGWDMALQVDFCGAPDTVDTFPPTSGDFGPVHGTDFAAESF
TASDETLYDASIWLTEATDGPLSITVHRDTPDGATVATAALAASPIGKRTVVFSPAVRLT
RGGRYVLAVRGGSVETHTGIVARRADDPTQQGWDASGPVTWDLALELSFGPGISSPSDLT
REQCTDRLAFPAGYVASVETAMRSKPDVWGNALMASASGPTYDNVKDYLLPLRYVGSPAG
MSGNQLTDSGVFYVAFGAPGTDFSQPGALHVADGSQVVSRAANGRRATVYVGGAGARERF
GLCEARLQEPALADGHQPVLQTDYVDADGVQYRQESFVAHLPSTSTPASFVKITAQRGSS
ALGATDLRIATGDTALVDAGGSLTSGGNVVMYDGAGWTLESGSQLRARVDLSDGLPHSLY
FVRPVNPATPTTFTADATSYATALAGLKSAWNTKLASGATYDVPEQRVMDAQRNLLIQNL
QLGWRYSYGNAYESFYQPESSSAVQRLGEYGFTTEARAGLQALVGMSKGTGYPNWERGEK
LSHAAAYWFLTGDTAFIRANTATYASYMAAMAAERARDPNGLLPKEFEGGDIPTRIYGTH
TQTVGWRGMRDMALVWRLIGERSLAATYEPEAAAFGRALRTAIDSSKRTVGRSTFIPHDL
LSGELPFDPVTGTKIGSYWNLLHPYALASGIFTPGSAEADSVWAYSRDEGALLLGLQRFN
YYPTRIGSVTPGGLPGYKTDGDDSVYAVERIRFLAAQDDPEQLVLALYGKLAHGMTRKTF
IAGEGHTIAPVPGEYFRSMYLSPTNANNDFFLVTLREMLVHVGEGTDGVPDSLRLAYSTP
RGWLEDGKSITVANAPTTFGQVGYRITSQLARRTVAVTVTLPPPSAAMREARLRLRLPAG
NAIGTATVVGRGTAVPFTGDTLDLAGLSGTVQVQVTVR
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcttcagattgcgtcgtctcatggcagtgccgctggtcgcggcggccgtgctcgcg
gtcggctccaccgccgcgtgggcggtcccgccgccgtgcccctcggggacgcccacgtcg
ttcctgcaggactccgtcggcggtgacggcaacgccgtctacggcggctaccacctcggc
gactcgttcgtcgcgagaggcggctcgatcacgcagctgacggtctggatgaagcaggcg
gccaacgctcccgtgacgctgtcggtgatctccggcagctcgatcggcggcaccgtggtc
ggcaccgcgacgatcgcctcgggcgtctccggcaaggccgtcgcgacgctcgcgagaccg
atcgccgtcacgctcggcgccacctacatcctcaaggtcaacgccccggccgccaccaga
gggctcgccgagctgatcccctccgccaccggcgaggtctacgccagagacggcagccac
ggcaacaccgactacagagcgtccggctgggagatggcgatgggcgtcgacttctgtggc
gccggcatcggcggctgcacgatcggcgcgccggccaccgtctcgcagtacgcctccacg
ggcgacggcaacgcgatcttcggcggctactacctcggcgactcgttcgtcgcgggcggc
agcgcgatcaccaagctgaccgtctggatggagcaggcggccgacgctcccgtgacgctg
tcggtgatctccggcagtgcgatcggcggcacggtcgtcggcaccgcgaccctcgcctcc
ggcgtgtccggcaaggccgaggtcgcgctcgcgacgccgatcgcggtcagagccggcagc
acgtacatcctcaaggtcaacgcgccggcggcgacgagagggacggcgagactgatcgcc
acctccggcgaggtctacgccagagacggcagccacggcaacaccgactacagagcgacc
ggctgggacatggcgctgcaagtcgacttctgcggcgcgcccgacaccgtcgacacgttc
ccgccgacctcgggcgacttcggcccggtccacggcaccgacttcgcggccgagtcgttc
accgcctccgacgagacgctctacgacgcctcgatctggctgacggaggcgaccgacggc
ccgctgtcgatcaccgtccatcgcgacacgcccgacggcgcgacggtcgcgaccgcggcg
ctcgctgccagcccgatcgggaagcggacggtcgtcttctcgcccgcggtgcggctcacc
agaggcggcagatacgtgctcgcggtccgcggcggctcggtcgagacgcacaccggcatc
gtcgcccggcgggctgacgacccgacccagcagggctgggacgcgagcggcccggtcacg
tgggacctggcgctggagctgtcgttcggccccggcatcagctcgccgagcgacctcacg
agagagcagtgcacggacagactcgccttcccggccggctacgtcgccagcgtcgagacg
gcgatgagatcgaagccggacgtgtggggcaacgcgctgatggcgagcgcgagcggcccg
acctacgacaacgtcaaggactacctgctgccgctgcgctacgtcggctcgccggccggc
atgagcggcaatcagctgaccgactccggcgtcttctacgtcgccttcggcgcgccgggg
accgacttctcccagccgggcgcgctgcacgtcgccgacggcagccaggtcgtctcgcgg
gccgccaacgggcgtcgcgcgacggtctacgtcggcggcgccggcgcgcgcgagcgcttc
ggcctgtgcgaggcgcggctgcaggagccggcgctcgccgacggccatcagccggtcctg
cagaccgactacgtcgacgccgacggcgtccagtacagacaggagtcgttcgtcgcgcac
ctgccgtcgacgagcacgccggccagcttcgtcaagatcaccgcccagagaggcagctcg
gcgctgggcgcgaccgacctgcggatcgcgaccggcgacacggcgctcgtcgacgcgggc
ggctcgctgaccagcggcggcaacgtcgtgatgtacgacggcgccggctggacgctcgag
agcggctcgcagctgcgcgccagagtcgacctctccgacggcctgccgcactcgctctac
ttcgtgcggccggtcaacccggcgactccgacgacgttcaccgccgacgcgacctcgtat
gcgacggcgctcgccggcctgaagtcggcgtggaacacgaagctggcgtcgggtgcgacc
tacgacgtgcccgagcagcgggtgatggacgcgcagcgcaacctgctgatccagaacctc
cagctcggctggcgctacagctacggcaacgcctacgagagcttctaccagccggagagc
agctcggcggtgcagcgcctcggcgagtacggcttcaccacggaggcgagagccggcctg
caagcgctggtggggatgtcgaagggcacgggctacccgaactgggagcgcggcgagaag
ctctcgcacgccgcggcgtactggttcctgaccggcgacaccgccttcatcagagcgaac
acggcgacgtacgcgagctacatggcggcgatggcggccgagcgggccagagacccgaac
gggctgctgccgaaggagttcgagggcggcgacatcccgacgagaatctatggcacgcac
acgcagacggtgggctggcgcggcatgcgcgacatggcgctcgtgtggagactgatcggc
gagagaagcctcgccgccacgtacgagcccgaggccgccgcgttcggcagagcgctgcgg
accgcgatcgacagctcgaagagaacggtcggcagatcgacgttcatcccgcacgacctg
ctgagcggcgagctgccgttcgacccggtcacggggacgaagatcggctcgtactggaac
ctgctgcacccgtacgcgctcgcgtccgggatcttcacgcccggcagcgccgaggcggac
agcgtgtgggcgtactcgcgcgacgagggcgcgctgctgctcggcctccagcgcttcaac
tactacccgacgagaatcgggtcggtgacgccgggtgggctgccgggctacaagaccgac
ggcgacgacagcgtctacgcggtcgagcggatccgcttcctcgccgcgcaggacgacccc
gagcagctggtgctggcgctgtacgggaagctcgcgcacgggatgacgcgcaagacgttc
atcgcgggcgaagggcacacgatcgcgccggtgccgggcgagtacttccgctcgatgtac
ctgtcgccgacgaacgccaacaacgacttcttcctcgtgacgctgcgcgagatgctcgtg
cacgtgggggaggggaccgacggcgttcccgactcgctgagactcgcctactcgacgccg
cgcggctggttggaggacggcaagtcgatcaccgtcgcgaacgcgccgacgacgttcggg
caggtcggctacagaatcacctcgcagctggcgagaagaacggtcgccgtcacggtgaca
ctgccgccgccgtccgccgcgatgagagaggcgcgcctgcgcctgcgcctgccggcgggc
aacgcgatcggcacggcgaccgtcgtcgggagagggaccgcggtcccgttcaccggtgac
acgctcgacctcgcggggctgagcggaacggtccaagttcaggtgactgtcagatag

DBGET integrated database retrieval system