KEGG   Conexibacter woesei: Cwoe_5132Help
Entry
Cwoe_5132         CDS       T01153                                 

Definition
(GenBank) oxidoreductase alpha (molybdopterin) subunit
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding
Motif
Other DBs
NCBI-ProteinID: ADB53541
UniProt: D3FDE9
Position
5491693..5493993
Genome map
AA seq 766 aa AA seqDB search
MARDLLPLGLDDEARLRVSHGPEHAAAGVPAVVWSMRHSLSRMGPVRTARLLARVNQKSG
FDCPGCAWPDPEHRHAAEFCENGAKAVAEEGTTRRADAAFFARHSVADLSAQTDHWLGRQ
GRLTEPMLLADGATHYEPIGWDDAFGIIVEELNALGSPDEANFYTSGRTSNEAAFAYQLL
VRAFGTNNLPDCSNMCHESSGSALTETIGIGKGSVSLEDLHAAELILVVGQNPGTNHPRM
LSALEEAKRRGAVIVSVNPLPEAGLMRFKNPQRPRGVLGHGTALTDRFLQIRVNGDLALF
KAVNRRLIELDRAHPGSVVDHAFVERHCTGFDALAADLAQLDPADVDAATGLPREQIDAL
ADLIASKRRIVACWAMGLTQHRNSVATIREIVNTLLLRGSIGKPGAGVCPVRGHSNVQGD
RTMGIYEKPQPAFLDALRDTFGFEPPREHGHDVVDAIRAMRDGRAHVFVAMGGNFLAAAP
DTAATAAALQRQRLTVQVSTKLNRSHLVTGRRALILPALGRTERDVQASGEQVVSVEDSM
SVVHASRGRLAPASPQLRSETAIVCGLARRLLGDRHAIPWQAFEDDYALLRDQIAATIPG
FEQFNARLAQPDGFVLPHPPRDELRFETPSGRAHLTANSLAVLRVPEGRLLLQTLRSHDQ
YNTTVYGLNDRYRGIRSGRRVVLVHAEDLAALGVADGAIVDVVSEWEDGVERRVERFRAV
AYPTARGCAAAYYPETNPLVPLDSQAERSGTPTSKSVVVRLEEPHA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgacctgctcccgctcggcctcgacgacgaggcgagactccgcgtctcacac
ggtcccgagcacgccgccgcgggcgtcccggcggtcgtctggtcgatgcggcactcgctc
agccgcatgggccccgtgcggaccgcgcgcctgctcgcgcgcgtcaaccagaagtccggc
ttcgactgccccggctgcgcgtggcccgaccccgagcaccggcacgccgccgagttctgc
gagaacggcgcgaaggcggtcgccgaggagggcacgacgagacgcgccgacgcggccttc
ttcgcccgccactcggtcgccgacctgtccgcgcagaccgaccactggctcgggcgccag
gggcggctgaccgagccgatgctgctggccgacggcgcgacgcactacgagccgatcggc
tgggacgacgcgttcgggatcatcgtcgaggagctgaacgcgctcggctcgcccgacgag
gcgaacttctacacctccggtcgcacgagcaacgaggcggcgttcgcctaccagctgctc
gtgcgcgcgttcgggacgaacaacctgccggactgctcgaacatgtgccacgagtcgtcc
ggctcggcgctgaccgagacgatcgggatcggcaagggcagcgtctcgctggaggacctg
cacgcggccgagctgatcctcgtcgtcggccagaaccccggcaccaaccacccgcgcatg
ctcagcgcgctggaggaggccaagcgccgcggcgccgtgatcgtcagcgtcaacccgctg
cccgaggccgggctgatgcgcttcaagaacccgcagcggcccaggggcgtgctcggccac
ggcaccgcgctgaccgaccgcttcctgcagatccgcgtcaacggcgacctcgcgctgttc
aaggccgtcaaccgccggctgatcgagctggaccgcgcgcaccccggcagcgtcgtcgac
cacgcgttcgtcgagcggcactgcaccggcttcgacgcgctcgccgccgacctcgctcag
ctcgaccccgccgacgtcgacgccgccaccggcctgccgcgcgagcagatcgacgcgctc
gccgacctgatcgcgtccaagcggcggatcgtcgcctgctgggcgatgggcctgacccag
caccgcaactcggtcgcgacgatccgcgagatcgtcaacacgctgctgctgcgcggctcg
atcggcaagcccggcgccggcgtctgccccgtccgcggccactccaacgtccagggcgac
cgcacgatggggatctacgagaagccccagccggcgttcctcgacgcgctgcgcgacacg
ttcgggttcgagccgccgcgcgagcacggccacgacgtcgtcgacgcgatccgcgcgatg
cgcgacggtcgcgcacacgtcttcgtcgcgatgggcggcaacttcctcgccgccgctccc
gacaccgccgcgacggccgccgcgctgcagcgccagcggctgacggtgcaggtctcgacg
aagctcaaccgctcccacctcgtgaccggccggcgcgcgctgatcctgcccgcgctcggc
cgcaccgagcgcgacgtgcaggccagcggcgagcaggtcgtctcggtcgaggactcgatg
tcggtcgtgcacgcctcgcgcgggcggctcgcgccggcctccccgcagctgcgctcggag
accgcgatcgtctgcggcctcgcgcgccgcctgctcggcgaccgccacgcgatcccgtgg
caggcgttcgaggacgactacgcgctgctgcgcgaccagatcgccgcgacgatccccggc
ttcgagcagttcaacgcgcgtctggcgcagcccgacggcttcgtgctgccgcacccgccg
cgcgacgagctgcgcttcgagacgccgtcggggcgcgcccacctgacggccaactcgctc
gccgtcctgcgcgtgcccgaaggccggctgctgctgcagacgctgcgctcccacgaccag
tacaacacgaccgtctacggcctcaacgaccgctaccgcgggatcagatcgggccgtcgc
gtcgtgctcgtgcacgccgaggacctcgccgcgctcggcgtcgcggacggcgcgatcgtc
gacgtcgtgagcgagtgggaggacggcgtcgagcggcgcgtcgagcgcttccgcgcggtc
gcctacccgaccgcgcgcggctgcgccgccgcctactacccggagacgaacccgctcgtc
ccgctcgactcccaggccgagcggtcgggcaccccgacgtcgaagtccgtcgtcgtgcgg
ctcgaggagccccacgcctga

DBGET integrated database retrieval system