KEGG   Conexibacter woesei: Cwoe_5138Help
Entry
Cwoe_5138         CDS       T01153                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like Lipase_3
Motif
Other DBs
NCBI-ProteinID: ADB53547
UniProt: D3FDF5
Position
complement(5497883..5499316)
Genome map
AA seq 477 aa AA seqDB search
MHPHPKRWLALAVIALAQFMVIMDTSIIGVALPEIQQDLGFSQENLSWVFNGYVVAFGGL
LLLGGRLADLFGAKRMFSLGWAILAVGSLAAGLAGSVGVEIAARAVQGVGAALIAPSALT
LLMMLFAHDPKELTKALALYGAAAPAGGTAGVFLGGVITEWISWPWIYYIYIPIAIAAIA
ATPSLMPAAPARRGRVDILGATAVTAGIALAVFAIVRAPEEGWGSTATLLSLGGAVALLA
GFVAIQATVRQPLVRLAIFKTPNLGAANLAQLLLGAAWIPMWYFLNLYLQQVLGFGAFAG
GAALLPMTLAIMLLMIVVAPRAIARFGFKVPTVAGLWILAIGLAGLSLARPDGNFAADVL
PASLVAAFGMALAFIPSLGTAISSARPEEGGLASGIVNTSYQVGSALGLAAMTALASAQG
ADQLGNLEALTDGFSAAFIGAAAIAAVGGLIALLTLRRPPATADANDRQQPSQQVGV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgcacccccaccccaagcgctggctcgcgctggccgtcatcgcgctcgctcaattcatg
gtcatcatggacacgtcgatcatcggcgtcgcattgcccgagattcagcaggatctcggc
ttcagccaggagaacctctcctgggtcttcaacggatacgtggtcgcgttcggcggcctg
ctgctgctcggtggacggctcgccgacctgttcggcgcgaagcggatgttcagcctcggc
tgggcgatcctcgccgtcggctcactcgccgcaggtcttgccggctccgtcggcgtcgag
atcgccgcccgtgccgtccagggcgtcggcgccgcgttgatcgcgccgagcgcgctgacc
ctgctgatgatgctcttcgcgcacgacccgaaggagctgacgaaggcgctcgcgctgtac
ggcgcggccgcaccggccggcggcaccgccggtgtcttcctcggcggcgtgatcaccgag
tggatcagctggccgtggatctactacatctacatcccgatcgcgatcgccgcgatcgcc
gcgacgccgtcgctgatgccggccgccccggcgcgccgtggccgcgtcgacatcctcggc
gcgaccgctgtcaccgcgggcatcgccctcgccgtgttcgcgatcgtccgtgccccggag
gagggttggggctccaccgccacgctgctctcgctcggcggcgccgtcgcactgctggcc
ggcttcgtcgcgatccaggccacggttcgccagccgctcgtgcggctggcgatcttcaag
acgccgaacctcggcgcggcgaacctcgcgcagctgctgctcggggccgcgtggatcccg
atgtggtacttcctcaacctctacctccagcaggtgctcggcttcggcgcgttcgcgggc
ggcgccgcgctgctgccgatgacgctggcgatcatgctgctgatgatcgtcgtggcgccg
cgcgcgatcgcccgcttcggcttcaaggtcccgaccgtcgcgggactgtggatcctcgcg
atcggcctcgcgggcctgtcgctggcgcgcccggacggcaacttcgccgccgacgtgctg
cccgcctcgctggtcgccgcgttcggcatggcactggcgttcatcccgtcgctcggcacg
gcgatctccagcgcgcgcccggaggagggcggtctcgcgtccgggatcgtcaacacctcc
taccaggtcggatcggcgctcgggctcgccgcgatgacggccctcgcgagcgcccagggc
gccgaccagctcggcaacctcgaagccctgaccgacgggttctccgccgcgttcatcggc
gccgccgcgatcgccgccgtcggcggactgatcgcgctgctgacgctgcgccggccgccg
gcgacggccgatgcgaacgaccggcagcagccatcgcaacaggtcggcgtctag

DBGET integrated database retrieval system