KEGG   Conexibacter woesei: Cwoe_5154Help
Entry
Cwoe_5154         CDS       T01153                                 

Definition
(GenBank) YceI family protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceI
Motif
Other DBs
NCBI-ProteinID: ADB53563
UniProt: D3FE71
Position
complement(5513243..5513800)
Genome map
AA seq 185 aa AA seqDB search
MASLAIQPFAGTFRAQPLPSSFAFAVRHSGVFWYRGSLSDVTATLRGSEDALALEGSARV
DSISVGEPAAMRASVLGPDFFDAERHPEIAFHSAAIRLDDDGRAEVDGELTMRGVTRPVI
ATGCYAPPRPSSFGEIAGVQLHTSFDRRDFGFDWQMELPGGGNAVGWDVEVDIDLLLIRE
EAAPR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcctcactcgcaatccagcccttcgcgggcaccttccgcgcccagccgctgccctcg
agcttcgcgttcgcggtgcgtcactccggcgtcttctggtatcgcggctcgctgtcagac
gtcacggcaacgctgcgcggcagcgaggacgcgctggcgctggaggggtccgcgcgggtc
gattccatctccgtgggcgagccggccgcgatgcgagcgagcgtgctcgggccggatttc
ttcgatgccgagcgccatcccgagatcgcgttccactcggcggcgattcggctcgacgac
gacggccgggcagaggtcgacggcgagctcacgatgcggggcgtcacgcgcccggtcatc
gccaccggttgctacgccccgccgcgaccgagcagcttcggcgagatcgcgggagtgcag
cttcacacgagcttcgaccgccgcgacttcggcttcgactggcagatggagctgccgggc
ggcggcaacgcggtcggctgggatgtggaggtcgacatcgatctgctgctcattcgcgag
gaagcagcgccgcgctga

DBGET integrated database retrieval system