KEGG   Conexibacter woesei: Cwoe_5291Help
Entry
Cwoe_5291         CDS       T01153                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cwo  Conexibacter woesei
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cwo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5653184..5653822)
Genome map
AA seq 212 aa AA seqDB search
MSSFAPPVQRLITELGRLPGIGGRTAQRLAFHLLRASEEDALALAEAIKEVKARIGLCEV
CFNLSDGPRCRICSDERRDAGLVCVVEEPSDIIPIERTHEFHGRYHVLGGALSPIDGIDP
EDLRIAELYTRVTPPADAPQDEHPTPIREVVLATNPTTTGEATALHIAAHLREQAPQVTV
TRLASGLPVGADLEYADELTLGRALSGRRALS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgttcgcgccacccgtccagcggctgatcaccgagctcggcagactgcccggc
atcggcggccgcacggcgcagcgactcgccttccacctgctgcgggcctccgaggaggac
gcgctcgcactcgccgaggcgatcaaggaggtcaaggcgcggatcgggctgtgcgaggtc
tgcttcaacctctccgacgggccgcgctgccgcatctgctctgacgagcgccgcgacgcc
ggcctcgtctgcgtcgtcgaggagccgtcggacatcatcccgatcgagcgtacgcacgag
ttccacgggcgctaccacgtgctcggcggcgcgctctcgccgatcgacgggatcgacccc
gaggacttgcggatcgcggagctgtacacgcgcgtgacgccgcccgccgacgcgcctcag
gacgagcatccgacgccgatccgcgaggtcgtgctcgcgacgaacccgaccacgacgggc
gaggcgaccgcgctgcacatcgccgcccacctgcgcgagcaggcgccgcaggtgaccgtc
acgcgcctcgcgagcggcctgccggtcggcgccgacctcgagtacgccgacgagctgacg
ctcggccgcgcgctctcgggccgccgcgccctctcctga

DBGET integrated database retrieval system