KEGG   Conexibacter woesei: Cwoe_5298Help
Entry
Cwoe_5298         CDS       T01153                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cwo  Conexibacter woesei
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cwoe_5298
Enzymes [BR:cwo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cwoe_5298
Peptidases [BR:cwo01002]
 Cysteine Peptidases
  Family C44
   Cwoe_5298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5661861..5663750
Genome map
AA seq 629 aa AA seqDB search
MCGIGAIFDPAGDTPAELLGRVATALRHRGPDGEAVRRLGPAALVHTRLAIIDVAGGDQP
FTSEDGRTSAIVNGEIYNHVELRGELEALGHVFATHSDCEVVLHGYEAWGLGVLERINGM
FGIALWDGAREQLVVARDAFGVKPVYWWTDGRRVAAASEVRALLATGWVGAALDPVALDH
FLTWRFVPSPRTLFAGVSKLAPATALVVSREGTRVESFRRPPGAPLEPADVDELTEEVAR
RFEQAVARQMMSDVPYGAFLSGGLDSAAIVAAMARATPDSPPLSFTIGFPGHGEDLDERA
PAAAHAAAIGARHQSTAMEMGDFLATLGSCVRSVEEPCGTASAPAAMELSRFTSQSVKVV
LSGQGADEPWGGYQRHQAAALLRLVDRVPRAARRPLGAAAEALPRNERAKRAARLLDVEA
GPARLLSIFDITAPELRRALLRGDGAEAAAERSARASQLLGDVGDRDLLDRALYLDTHLF
LPDQLLVWGDKTSMASGLEQRVPFLDQELMGFVERIPARVRMKGARRKWLYRRSMAELVP
PAVLQRRKHPFATPYDDWLRSALGDEVRQRFAATEPLSEVIDAATVARLVTEHQSGRSDH
KRVLYCLLELSQWHREFVEQATPVSGAVA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcggcgccatcttcgatccggcgggcgacacccctgccgagctgctcggt
cgcgtcgcgacagcgctgcgccatcgcggacccgacggcgaggcggtccggcggctcgga
cccgcggcgctcgtgcacacgcgcctggcgatcatcgacgtcgcgggcggtgaccagccg
ttcacgtccgaggacggtcgcacgagcgcgatcgtcaacggcgagatctacaaccacgtc
gagctgcgcggcgagctggaggcgctcggccacgtcttcgccacgcactcggactgcgag
gtcgtgctgcacggctacgaggcgtggggcctcggcgtgctggagcgcatcaacggcatg
ttcgggatcgcgctgtgggacggcgcgcgcgagcagctcgtcgtcgcgcgcgacgcgttc
ggcgtcaagccggtctactggtggaccgacggtcggcgcgtcgcggcggcgtccgaggtg
cgggcgctgctcgcgaccggctgggtcggcgcggcgctcgacccggtcgcgctcgaccac
ttcctcacgtggcgcttcgtgccctcgccgcggacgctgttcgccggcgtctcgaagctg
gcgcccgcgaccgcgctcgtcgtctcgcgcgagggcacccgcgtcgagagcttccgccgc
ccgcccggcgcgccgctcgagccggccgacgtcgacgagctgaccgaggaggtcgcgcgg
cgcttcgagcaggcggtcgcgcggcagatgatgtccgacgtgccgtacggcgcgttcctc
agcggcggcctcgactccgccgcgatcgtcgccgcgatggcgcgcgcgacgccggacagc
ccgccgctcagcttcacgatcggcttccccgggcacggcgaggatctcgacgagcgcgcg
cccgcggccgcgcacgccgccgcgatcggcgcgcggcaccagtcgaccgcgatggagatg
ggcgacttcctcgcgacgctcggcagctgcgtccgcagcgtcgaggagccctgcggcacc
gcgtcggcgccggccgcgatggagctgagccgcttcacctcgcagtcggtcaaggtcgtc
ctgtcgggtcagggcgcggacgagccgtggggcgggtaccagcgccaccaggcggccgcg
ctcctgcggctggtcgaccgcgtcccgcgcgcggcgcgccgtccgctcggcgcggcggca
gaggcgctgccgcgcaacgagcgcgccaagcgcgccgcccggctgctcgacgtcgaggcg
ggccccgcgcggctgctgtcgatcttcgacatcaccgcgcccgagctgcgccgcgcgctg
ctgcgcggcgacggcgccgaggccgccgccgagcgctcggcgcgcgcctcccagctgctc
ggcgacgtcggcgaccgcgacctgctcgaccgcgcgctgtacctcgacacgcacctcttc
ctgcccgaccagctgctcgtctggggcgacaagacgtcgatggcgagcgggctggagcag
cgcgtcccgttcctcgaccaggagctgatgggcttcgtcgagcggatcccggcgcgcgtg
cggatgaagggcgcgcggcgcaaatggctctaccggcgctcgatggccgagctggtgccg
ccggcggtgctgcagcggcgcaagcacccgttcgcgacgccgtacgacgactggctgcgc
tcggcgctgggcgacgaggtgcggcagcgcttcgccgcgaccgagccgctgtcggaggtg
atcgacgccgcgaccgtcgcgcggctcgtgaccgagcaccagtcggggcgatcggaccac
aagcgcgtcctctactgcctgctggagctgtcgcagtggcatcgcgagttcgtcgagcag
gcgaccccggtcagcggagcggtcgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system