KEGG   Conexibacter woesei: Cwoe_5408Help
Entry
Cwoe_5408         CDS       T01153                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cwo  Conexibacter woesei
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cwo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5783062..5785287
Genome map
AA seq 741 aa AA seqDB search
MAPQLATWPPADGAAFAGEVVVKGQRFANEESGFAVLDGEWDGERIALVGPLVHLEQGER
AAVAGTWVIDPRYGPQVRVREAHPVALADDAAVLAYLRRVRHVGPRRAAALQQAFGAEVL
NAIDEDPRGAFTRAGLTPQRATEATRSWDALRATRGLHLLLAPHGLAHLASRIHQHYGDR
AHRVVRERPYDLTSVFGVGFVTADAIAHGLGAPLESPARTRAAILHALGEGERDGSTCQP
AAALLLRTRELLSAQAPPPAAFLAELEEGGDVETEQDDEAVWVYRAETARLERELAERVT
ALLDGDGSDKLSDPVEPPDAGADGVELTAEQWAGVRGAFVHRLSVVTGGPGTGKTASIRM
IGQIARDQRARTMLVAPTGRAALRMTEATGLDASTVHSALGWIPGEGPVHDEDTPLRCDL
VIVDETSMANLELLVTLLRAIGPGTHVVLVGDADQLAPVGAGKPFAELVASGRVPTARLQ
HIFRQAAGSMIVQGAHAIRVGNPPSFVRAEEMRHDLFFIARPDPVAAREEIVSLVSERLP
QHYGVDPNADIQVFAPIYRGELGIDALNRSLRAALNPAGREIGNGRLRVGDKLMLVGRNL
HELGVMNGTLLRLLDEVGGGSSEDEDARDARGAREAGGVLVGVDGGAVVQIPATEVGQLQ
LAYACSVHRGQGIELPIAIVVAHPAAGGRFLRREMLYTAITRSTVATVIVGTPDMVARAA
RTTDAGRRHSRLAQRLDALHA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcagctcgccacctggccgcccgccgacggcgccgcgttcgccggcgaggtc
gtcgtcaagggccagcgcttcgcgaacgaggagagcggcttcgccgtcctcgacggcgaa
tgggacggcgagcggatcgcgctcgtcgggccgctcgtccacttggagcagggtgagcgt
gccgccgtcgccggcacgtgggtgatcgacccgcgctacggcccgcaggtgagagtccgc
gaggcgcatcccgtcgcgctcgcggacgacgccgccgtgctcgcctacctgcgcagagtc
cgccacgtcggcccgcgccgcgcggccgcgctccagcaggcgttcggcgccgaggtgctg
aacgcgatcgacgaggacccgcgcggcgccttcacgcgcgcagggctcacgccccagcgt
gccaccgaggcgacgcgctcgtgggacgcgctgcgcgcgacgcgcggactgcacctgctg
ctggcgccgcacgggctcgcccatctcgcgagcaggatccaccagcactacggcgaccgc
gcccaccgcgtcgtgcgcgagcggccgtacgacctgacgagcgtcttcggggtcggcttc
gtcaccgccgacgcgatcgcgcacggcctcggcgcgccgctggagagcccggcgcgcacg
cgcgcggcgatcctgcacgcgctcggcgagggcgagcgggacggctccacctgccagccg
gcggccgcgctgctgctgcgcacgcgcgagctgctgagcgcgcaggcgccgcccccggcg
gcgttcctcgccgagctggaggagggcggcgacgtcgagaccgagcaggacgacgaggcg
gtgtgggtctatcgcgccgagacggcgcgactggagcgcgagctggccgaacgcgtgacg
gcactgctcgacggcgacggctcggacaagctgagcgacccggtcgagccgcccgacgcg
ggtgccgacggcgtcgagctgaccgctgagcagtgggcgggcgtgcgcggcgcgttcgtc
caccggctgtcggtcgtcacgggcgggccgggcaccggcaagacggcgagcatccgcatg
atcggccagatcgcgcgcgaccagcgagcgcgcacgatgctcgtcgcgccgaccggacgc
gccgcgctgcggatgaccgaggcgacggggctcgacgcctcgaccgtccactcggcgctc
ggatggatccccggcgaaggccccgtgcacgacgaggacacgccgctgagatgcgacctc
gtgatcgtcgacgagacgtcgatggcgaacctcgagctgctcgtgacgctgctgcgcgcg
atcggcccggggacgcacgtcgtgctcgtcggcgacgccgatcagctcgcgcccgtcggc
gccggcaagccgttcgccgagctggtcgcctccggacgggtgccgaccgcgcggctgcag
cacatcttccgccaggcggccggttcgatgatcgtccagggcgcgcacgcgatccgcgtc
ggcaacccgccgtcgttcgtgcgcgcggaggagatgcgccatgacctcttcttcatcgcg
cggccggatccggtggcggcacgcgaggagatcgtctcgctcgtgagcgagcggctgccg
cagcactacggcgtcgacccgaacgccgacatccaggtgttcgcgccgatctaccgcggc
gagctggggatcgacgcgctcaacagatcgctgcgggcggcgctcaacccggcggggcgc
gagatcggcaacggccgcctgcgggtcggcgacaagctgatgctcgtcggccgcaacctg
cacgagctgggcgtgatgaacgggacgctgctgcggctgctggacgaagtcgggggcgga
tcgtcggaggacgaggacgccagagacgcgagaggcgcgagagaggccgggggcgtgctc
gtcggcgtcgacggcggcgcggtcgttcagatccccgcgaccgaggtcggccagctgcag
ctcgcctacgcctgctcggtccaccgcgggcaggggatcgagctgccgatcgcgatcgtc
gtcgcgcacccggcggcgggtggccgcttcctgcgccgcgagatgctctacaccgcgatc
acccgctcgaccgtcgcgacggtgatcgtcggcacgccggacatggtcgcccgcgctgcg
cgcacgaccgacgccggccgccgccacagccgcctcgcgcagcgcctcgacgccctccac
gcatga

DBGET integrated database retrieval system