KEGG   Conexibacter woesei: Cwoe_5543Help
Entry
Cwoe_5543         CDS       T01153                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cwo  Conexibacter woesei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_5543
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_5543
   00640 Propanoate metabolism
    Cwoe_5543
   00660 C5-Branched dibasic acid metabolism
    Cwoe_5543
Enzymes [BR:cwo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cwoe_5543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5936087..5937241
Genome map
AA seq 384 aa AA seqDB search
MDLLEYQGKQLFARHGIPVPSGKPAATVQEAVAAADEIGYPCVVKAQVLIGGRGKAGGVK
LAKDRAEATQYATDILGMDIKGFTVHEVWIEGASEIAEEYYASIVFDRAAKAPLVMLSTQ
GGMDIEEVAEKTPDALARLHVDPLLGFQDFHGRKLAFAAGIPGDLIRPVGAMLAKLYETF
VAEEAMLIEVNPLIITPGRDVVALDAKVTLDGNSLYRHPDNAALRDPSAEDPQEQMAHER
GLTYVKLDGDIGILGNGAGLVMSTLDVVAQAGGAPANFLDAGGGSKADAIVSAVEVILSD
AKVRAVLFNIFGGITRCDEVAKGLIEAFDVVKPTVPFVVRLDGTNDVEGRKLLADANLPN
VATAKTMNEAAEKVVELSKTGVAA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacctgctcgaatatcagggcaagcaactcttcgcccgtcacggaatccccgtcccc
tccgggaagccagccgccacggtgcaagaggccgtcgccgctgctgatgaaatcggatac
ccctgcgtcgtcaaggcgcaagtcctgatcggcggccgtgggaaggccggcggcgtcaag
ctcgccaaggacagagcggaggcgacgcagtacgccaccgacatcctcggcatggacatc
aagggcttcaccgtccacgaggtctggatcgagggcgcctcggagatcgccgaggagtac
tacgcctcgatcgtcttcgaccgcgccgccaaggccccgctcgtgatgctctcgacgcag
ggcggcatggacatcgaggaggtcgcggagaagacgccggacgcgctcgcgagactccac
gtcgacccgctgctcggcttccaggacttccacggccgcaagctcgcgttcgcggccggc
atccccggcgacctgatccgccccgtcggcgcgatgctggcgaagctctacgagacgttc
gtcgccgaagaggcgatgctgatcgaggtcaacccgctgatcatcacgccgggccgcgac
gtcgtcgcgctcgacgcgaaggtcacgctcgacggcaactcgctctaccgccacccggac
aacgcggcgctgcgcgacccctccgccgaggacccgcaggagcagatggcgcacgagcgc
ggcctcacctacgtgaagctcgacggcgacatcggcatcctcggcaacggcgccgggctc
gtgatgtcgacgctcgacgtcgtcgcgcaggccggcggcgcgcccgccaacttcctcgac
gccggcggcggatcgaaggccgacgcgatcgtcagcgcggtcgaggtgatcctctccgac
gcgaaggtcagagcggtcctcttcaacatcttcggcggcatcacgcgctgcgacgaggtc
gccaagggcctgatcgaggcgttcgacgtcgtcaagccgaccgtcccgttcgtcgtgcgg
ctcgacggcaccaacgacgtcgaggggcgcaagctgctcgccgacgcgaacctgccgaac
gtcgcgacggcgaagacgatgaacgaggcggccgagaaggtcgtcgagctgtccaagacc
ggagttgcggcatga

DBGET integrated database retrieval system