KEGG   Conexibacter woesei: Cwoe_5543Help
Entry
Cwoe_5543         CDS       T01153                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cwo  Conexibacter woesei
Pathway
cwo00020  Citrate cycle (TCA cycle)
cwo00640  Propanoate metabolism
cwo00660  C5-Branched dibasic acid metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Module
cwo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cwo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_5543
   00640 Propanoate metabolism
    Cwoe_5543
   00660 C5-Branched dibasic acid metabolism
    Cwoe_5543
Enzymes [BR:cwo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cwoe_5543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADB53948
UniProt: D3F0L4
Position
5936087..5937241
Genome map
AA seq 384 aa AA seqDB search
MDLLEYQGKQLFARHGIPVPSGKPAATVQEAVAAADEIGYPCVVKAQVLIGGRGKAGGVK
LAKDRAEATQYATDILGMDIKGFTVHEVWIEGASEIAEEYYASIVFDRAAKAPLVMLSTQ
GGMDIEEVAEKTPDALARLHVDPLLGFQDFHGRKLAFAAGIPGDLIRPVGAMLAKLYETF
VAEEAMLIEVNPLIITPGRDVVALDAKVTLDGNSLYRHPDNAALRDPSAEDPQEQMAHER
GLTYVKLDGDIGILGNGAGLVMSTLDVVAQAGGAPANFLDAGGGSKADAIVSAVEVILSD
AKVRAVLFNIFGGITRCDEVAKGLIEAFDVVKPTVPFVVRLDGTNDVEGRKLLADANLPN
VATAKTMNEAAEKVVELSKTGVAA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacctgctcgaatatcagggcaagcaactcttcgcccgtcacggaatccccgtcccc
tccgggaagccagccgccacggtgcaagaggccgtcgccgctgctgatgaaatcggatac
ccctgcgtcgtcaaggcgcaagtcctgatcggcggccgtgggaaggccggcggcgtcaag
ctcgccaaggacagagcggaggcgacgcagtacgccaccgacatcctcggcatggacatc
aagggcttcaccgtccacgaggtctggatcgagggcgcctcggagatcgccgaggagtac
tacgcctcgatcgtcttcgaccgcgccgccaaggccccgctcgtgatgctctcgacgcag
ggcggcatggacatcgaggaggtcgcggagaagacgccggacgcgctcgcgagactccac
gtcgacccgctgctcggcttccaggacttccacggccgcaagctcgcgttcgcggccggc
atccccggcgacctgatccgccccgtcggcgcgatgctggcgaagctctacgagacgttc
gtcgccgaagaggcgatgctgatcgaggtcaacccgctgatcatcacgccgggccgcgac
gtcgtcgcgctcgacgcgaaggtcacgctcgacggcaactcgctctaccgccacccggac
aacgcggcgctgcgcgacccctccgccgaggacccgcaggagcagatggcgcacgagcgc
ggcctcacctacgtgaagctcgacggcgacatcggcatcctcggcaacggcgccgggctc
gtgatgtcgacgctcgacgtcgtcgcgcaggccggcggcgcgcccgccaacttcctcgac
gccggcggcggatcgaaggccgacgcgatcgtcagcgcggtcgaggtgatcctctccgac
gcgaaggtcagagcggtcctcttcaacatcttcggcggcatcacgcgctgcgacgaggtc
gccaagggcctgatcgaggcgttcgacgtcgtcaagccgaccgtcccgttcgtcgtgcgg
ctcgacggcaccaacgacgtcgaggggcgcaagctgctcgccgacgcgaacctgccgaac
gtcgcgacggcgaagacgatgaacgaggcggccgagaaggtcgtcgagctgtccaagacc
ggagttgcggcatga

DBGET integrated database retrieval system