KEGG   Conexibacter woesei: Cwoe_5695Help
Entry
Cwoe_5695         CDS       T01153                                 

Definition
6-phosphatase (EC:3.1.3.39)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cwo  Conexibacter woesei
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cwo00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cwo00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cwo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6093590..6095425)
Genome map
AA seq 611 aa AA seqDB search
MKRPTRTLALATVLALAGGATATALTFDGKEDRSAAVASAIDPSTPKNVILLIGDGMGES
EITAARNYVGVTTARLNMDTIPFRGVATTYAVNDAAATRPNFVTDSAGGGSQWSTGRKTL
ASRISQAPTDDPAVPGTNAGYDTALEIAKRLGKRTGNVTTSEVTDATPAAMSAHISERDC
KGPEATRTLCPQETKAAGGLGSIAEQQIDLRMDVLLGGGGKDFRQTLDGSARTVFDYAAE
RGFRRVANKDELAAITSLDGGPVLGVFDDGIFEQQYNDDRAKRLGEIETIRCDETHGRTL
EPHMPQLSEMTQKAIDLLESPSGFFLQVEGASIDKQAHTAAGCGQIGELIAFDEAIGVAL
RYQREHPDTLVVVAADHAHAGLIVSPTTDTTAGPPGYSQIIVTRDGTPMMLTYGTAGGVA
LPQKAKTQQHTGSAVPVMAIGPQAANVSGAHDLTDLFPLISFQRTPSELEQPETVTVTQT
TTVPGPATTTTVPGPATTVPGPERTVERPGPAAAPKLVAGVAAPPRVRVAELRAGLPLTL
VATRDGRARVELTDGSGRTLARKTVAVRADRAAATRLAVQPRGDVRRVRVRVTVSAGGQR
AQASASVAIGR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaccgacccgcaccctggcgctggcgacggtgctcgcgctcgccggcggcgcg
accgcgaccgcgctcaccttcgacggcaaggaggaccgctcggccgcggtcgcctccgcg
atcgacccgagcacgccgaagaacgtgatcctgctgatcggcgacgggatgggcgagtcg
gagatcaccgcggcacgcaactacgtcggcgtcacgaccgcgcgcctgaacatggacacg
atcccgttccgtggcgtcgcgacgacgtacgcggtcaacgacgccgccgccacgcggccg
aacttcgtgaccgactctgccggcggcggcagccagtggtcgacgggcaggaagacgctc
gccagccgcatctcgcaggcgccgaccgacgatcccgccgtgcccggcacgaacgccggc
tacgacaccgcgctggagatcgccaagcgactcggcaagcgcaccggcaacgtcaccacc
tccgaggtcaccgacgcgacgccggccgcgatgtcggcgcacatcagcgaacgcgactgc
aaggggcccgaggcgacccgcacactctgtccgcaggagacgaaggcggcgggtgggctc
ggctcgatcgccgagcagcagatcgacctgcggatggacgtcctgctcggcggcggcggc
aaggacttcagacagacgctcgacggctccgccagaaccgtcttcgactacgccgccgag
agaggcttccggcgcgtcgcgaacaaggacgagctggccgcgatcacgtcgctggacggc
ggccccgtgctcggcgtcttcgacgacggcatcttcgagcagcagtacaacgacgatcgc
gcgaagcggctcggcgagatcgagacgatcagatgcgacgagacgcacggcagaacgctc
gagccgcacatgccgcagctgtcggagatgacgcagaaggcgatcgacctgctggagagc
ccgagcggcttcttcctccaggtcgagggcgcctcgatcgacaagcaggcgcacacagcg
gccggctgcgggcagatcggcgagctgatcgccttcgacgaggcgatcggcgtcgcgctg
agataccagcgcgagcaccctgacacgctcgtcgtcgtcgcggccgaccacgcgcacgcc
ggcctgatcgtcagcccgaccacagacacgacggcgggcccgcccggctacagccagatc
atcgtgacgcgcgacggcacgccgatgatgctcacctacggcacggccggcggcgtcgcg
ctcccgcagaaggcgaagacgcagcagcacacgggctcggcggtcccggtgatggcgatc
ggcccgcaggcggcgaacgtctccggtgcgcacgacctgaccgacctcttcccgctgatc
tcgttccagcgcacgccgtcggagctggagcagcccgagacggtgaccgtgacgcagacg
acgacggtccccggcccggccacgaccacgaccgtccccggcccggccacgacggtgccg
gggccggagcggacggtggagcggcccggcccggccgccgcgccgaagctggtggcgggc
gtcgccgcgccgccgcgtgtgcgggtggcggagctgcgcgcaggactgccgctgacgctc
gtcgcgacgcgcgacggccgcgcgcgtgtcgagctgaccgacggcagtggccgcacgctc
gcgcgcaagacggtcgcggtgcgcgcagaccgcgcggccgcgacgcgcctcgccgtgcag
ccgcgcggcgacgtgcgcagagtgcgcgtgcgcgtcacggtgagcgccggtgggcagcgc
gcgcaggcgtcggcgagcgtcgcgatcgggcgctga

DBGET integrated database retrieval system