KEGG   Conexibacter woesei: Cwoe_5698Help
Entry
Cwoe_5698         CDS       T01153                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cwo  Conexibacter woesei
Pathway
cwo00620  Pyruvate metabolism
cwo00630  Glyoxylate and dicarboxylate metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cwoe_5698
   00630 Glyoxylate and dicarboxylate metabolism
    Cwoe_5698
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Cwoe_5698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADB54100
UniProt: D3F1R9
Position
complement(6098457..6100034)
Genome map
AA seq 525 aa AA seqDB search
MKEPPITPLTVSLARPPHDERLAAVVSPEALAFLAELHGRFGERRDGLLAARRERPAPAG
FLDATREIREGDWTVAPPRGDYADRRVEITGPTDRKLVINALNSGARGFMADFEDATTPL
WGTVLEGQRNLTEAIDGTIVHEEADGRRYELNDEVATLLVRPRGWHLPEQHVTAGGEPLA
GALVDAGLFLFHNGRRLLERGSAPYLYLPKLEHHDEAALWHDVLSWCEQALGLPHGTVRT
TVLIETLPAVFQMEEILFALRERSYGLNAGRWDYLFSAIKTFRDRADMVLPNRTDVSMTV
PFMRSYTELLVATCHRRGAFAMGGMAALIPSRSDAEATARAVAAVREDKEREAGAGFDGT
WVAHPGVVAVAEEAFDVVLGARPNQIERRRDDVRPDAAALLDLGATPGAVTEAGVRGACR
VGFLYLSAWLGGRGAVGIDGLMEDAATAEICRAQLWQWIRHATPLDDGRPVTRELVSALL
AEEVARTGVEDATAQEILEQVALAEEFPEFLTLIAYPRLEERAPA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
ctgaaggagcctcccatcacccccctgaccgtctcactcgcccgcccgccgcacgacgag
cggctcgccgccgtcgtctcgcccgaggcgctcgcgttcctcgccgagctgcacggccgg
ttcggcgagcggcgcgacggcctgctcgccgcccgccgcgagcgtcccgcgccggccggc
ttcctcgacgcgacgcgcgagatccgcgagggcgactggacggtcgcgccgccgcgcggc
gactacgccgaccgccgcgtcgagatcaccgggccgaccgaccgaaagctcgtcatcaac
gcgctcaactcgggcgcacgcggcttcatggccgacttcgaggacgcgacgacgccgctg
tgggggacggtgctggaggggcagcgcaacctgaccgaggcgatcgacggcacgatcgtc
cacgaggaggccgacggccgccgctacgagctgaacgacgaggtcgcgacgctgctggtg
cgcccgcgcggctggcacctgcccgagcagcacgtgaccgccggaggcgagccgctcgcg
ggcgcgctcgtcgacgccggcctgttcctgttccacaacggtcgccgcctgctcgaacgc
ggctcggcgccgtacctctacctgccgaagctcgagcaccacgacgaggccgcgctgtgg
cacgacgtgctgagctggtgcgagcaggcactcgggctcccgcacgggacggtccgcacg
acggtgctgatcgagacgctgcccgcggtcttccagatggaggagatcctgttcgcgctg
cgcgagcgctcctacggcctcaacgccggccgctgggactatctcttctccgcgatcaag
acgttccgcgaccgcgccgacatggtcctgccgaaccgcaccgacgtgtcgatgacggtc
cccttcatgcgctcctacaccgagctgctcgtcgccacctgccaccgccgcggcgcgttc
gcgatgggcgggatggcggcgctgatcccgtcgcgcagcgacgccgaggcgacggcgcgc
gcggtcgccgccgtgcgcgaggacaaggagcgcgaggcgggcgccggcttcgacggcacg
tgggtcgcgcaccccggcgtcgtcgccgtcgcggaggaggcgttcgacgtcgtgctgggc
gcgcggccgaaccagatcgagcgccgccgcgacgacgtccgtcccgacgccgccgcgctg
ctcgacctcggcgcgacgccgggcgccgtcaccgaggcgggcgtccgcggcgcctgccgc
gtcggcttcctctacctctccgcctggctcggcggccgcggcgccgtcggcatcgacggg
ctgatggaggacgcggcgacggccgagatctgccgcgcgcagctgtggcagtggatccgc
cacgcgaccccgctcgacgacggccgcccggtcacgcgcgagctggtctcggcgctgctc
gccgaggaggtcgcgcggacgggcgtggaggacgcgacggcgcaggagatcctcgagcag
gtcgcgctcgcggaggagttccccgagttcctgacgctgatcgcgtacccgcggctggag
gagcgggcgccggcgtag

DBGET integrated database retrieval system