KEGG   Conexibacter woesei: Cwoe_5932Help
Entry
Cwoe_5932         CDS       T01153                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cwo  Conexibacter woesei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cwoe_5932
Enzymes [BR:cwo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cwoe_5932
Exosome [BR:cwo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cwoe_5932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6343252..6344235)
Genome map
AA seq 327 aa AA seqDB search
MAFPLTRLRRLRRTGALRGLVRETQLDAGDFVLPLFVTHGSDRREPIAAMPGVARLSIDH
AVTEAGEAAALGIPAVMLFGIPDQKDEEGSGAWDDEGVVQLAIRAIKDAHPDLLVIPDLC
LCEYTSHGHCGVVRDDGRVDNDASLELLARTAVSHARAGADVIAPSDMMDGRVGVLRGAL
DEAGFSDLPILAYSAKFASAYYGPFREAADSTPSFGDRRSYQMDPANGDEALREVALDVE
EGADLLMVKPALAYLDVIRRVKDAHNLPLVAYNVSGEYAMVKAAAAAGHLDERATVLETL
TAIRRAGADIVITYHAKDAARWLQEAT
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcccctcacccgcctgcgccggctgcggcgcacgggagcgctgcgggggctg
gtgcgcgagacgcagctcgacgccggcgacttcgtgctcccgctgttcgtcacgcacggc
agcgaccgccgcgagccgatcgccgcgatgcccggcgtcgcacggctgtcgatcgaccac
gccgtcaccgaggccggcgaggcggccgcgctcgggatcccggccgtgatgctgttcggc
atcccggaccagaaggacgaggagggctccggcgcctgggacgacgagggcgtcgtccag
ctcgcgatccgcgcgatcaaggacgcccacccggacctgctcgtgatccccgacctctgc
ctctgcgagtacaccagccacggccactgcggcgtggtgcgcgacgacggacgcgtcgac
aacgacgcgtcgctcgagctgctcgcgcgcaccgccgtctcgcacgcgcgcgccggcgcc
gacgtgatcgcgccgagcgacatgatggacgggcgcgtcggggtgctgcgcggcgcgctc
gacgaggccggcttcagcgatctgccgatcctcgcctactcggccaagttcgcctcggcg
tactacgggccgttccgcgaggcggccgactcgacgccgtcgttcggcgaccgccgcagc
taccagatggatcccgccaacggcgacgaggcgctgcgcgaggtcgcgctcgacgtcgag
gagggcgccgacctgttgatggtcaaacccgcgctcgcctatctcgacgtgatccgccgc
gtcaaggacgcccacaaccttccgctcgtcgcctacaacgtcagcggcgagtacgcgatg
gtcaaggcggcagctgccgccggccatctcgacgagcgcgccaccgtgctcgagaccctc
accgcgatccgccgggccggcgcggacatcgtcatcacctaccacgccaaggacgccgcc
cgctggctccaggaggcgacatga

DBGET integrated database retrieval system