KEGG   Synechococcus sp. JA-3-3Ab: CYA_0193Help
Entry
CYA_0193          CDS       T00318                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cya00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
191016..192194
Genome map
AA seq 392 aa AA seqDB search
MQAITLLGSTGSIGTQTLDLVAQYPERFRVVGLTSYSNVTLLAEQVWRFRPQIVAIGREE
LLPELRSLLTGMRPLPELVAGTEGLCQVAAHPAAQRVVTGIVGCAGLLPTLAAIRAGKDI
ALANKETLVAGGPVVLPLVREYGVKLIPVDSEHSAIFQCLQGVPPGSLRRILLTASGGAF
RDWPAEKLDQVTLADALKHPNWVMGRKITIDSATLMNKGLEVIEAHWLFGLDYDRIEVLI
HPQSIVHSLIELADTSVLAQLGWPDMHLPILYGLSWPERLATPWDPLDLVKLGSLTFKAP
DHRKYPCLQLAYAAGQAGGTLPAVLNAANEAAVALFLQERIRFLDIPRLLEQVCERHQVI
PAPSLEDILEVDAWARQQVELLAQQAPAQVLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatcactctgctcggctccaccggctccattggcacccaaactctggatttg
gtggcccagtatccagagcgttttcgggttgtcggcttgaccagctacagcaatgttacc
ctcctggcagaacaggtgtggcggtttcggccccagattgtggccatcggtcgggaggag
ctgctgccggagctgcgatccctgctgaccgggatgcggccgctgccggagctggtggcg
ggaacggaggggctgtgtcaggtggcggcccacccggcggcccagcgggtggtgaccggg
atcgttggctgtgccggcctcttgcccaccttggccgctatccgcgccggcaaagacatt
gccctggccaacaaagaaaccctggtggcaggcggcccggtggtgctgcccctggtacga
gagtacggcgtcaagctcatcccggtggactcggagcattcggccatctttcaatgccta
cagggggtgccgccgggatccctgcgcaggatcttgttgacggcttccgggggagctttt
cgggattggcctgccgaaaaactagatcaggtcaccttggccgacgccctcaaacacccc
aactgggtgatggggcgcaagatcaccatcgactcggccaccctgatgaacaagggcctg
gaggtgatcgaggcccactggctgtttggtttggattatgaccggatcgaggtcctcatc
cacccccagagcattgtccactccttgatcgagctggcagatacttctgttctggcccag
ttgggctggccggatatgcacctgcccatcctctatggcctcagttggccggagcgctta
gccaccccttgggatcccctcgatttggtcaagctgggatccctcacttttaaggctccg
gatcaccgcaagtacccttgcctacaactggcttatgctgctggacaggcaggaggaacc
ctgccggcagtgttgaatgccgccaacgaagcggcggtggccctcttcctacaggagcgc
atccgctttttggacatccctcgccttttggagcaggtgtgcgagcggcaccaggtcatc
cctgcccccagcctggaggacattctggaagtggatgcctgggcgcggcaacaggtggag
ctgctggcgcagcaggccccggcccaagttctggcctga

DBGET integrated database retrieval system