KEGG   Synechococcus sp. JA-3-3Ab: CYA_0223Help
Entry
CYA_0223          CDS       T00318                                 

Gene name
trpA-1
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00260  Glycine, serine and threonine metabolism
cya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01130  Biosynthesis of antibiotics
cya01230  Biosynthesis of amino acids
Module
cya_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CYA_0223 (trpA-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CYA_0223 (trpA-1)
Enzymes [BR:cya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CYA_0223 (trpA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth TMP-TENI FMN_dh ThiG NanE PucR PcrB
Motif
Other DBs
NCBI-ProteinID: ABC98447
CyanoBase: CYA_0223
CYORF: CYA_0223
UniProt: Q2JQU8
Position
complement(226682..227497)
Genome map
AA seq 271 aa AA seqDB search
MPSRITACFQALRSRGEAALIPYLTAGDPNLETTFAALQVLEENGADLIELGVPYSDPLA
DGPVIQAAATRALSRGVTLGDILQGLRGLSLRAPLVLFTYYNPIHQLGIPTFVRQLRQAG
CAGLVVPDLPLEEAGSLREATQAEGIDLILLVAPTSPAERMRRIAQQSSGFIYLVSTTGV
TGERATLEQRIPALLQQLRQYTSLPIGVGFGISTPDQARQIALWGADAAIVGSAFVQRLA
KAPTPAQGLQQIAHFCRDLKAALQGIGTPQH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccagccggatcaccgcgtgttttcaggcgctgcgcagccgcggcgaagccgccctc
atcccctacctcaccgccggggatcccaacttggaaaccacctttgcggccctgcaagtt
ttggaggagaacggcgccgacctcatcgagttgggggtgccctattcggatcccctggcc
gatgggccggtgatccaggcagcagccacccgcgccctcagccggggcgtcaccttgggc
gacatcttgcagggcttgcggggcctctcgctgcgggctcccctcgtcctgttcacctac
tacaaccccatccaccagctcggcatccccacctttgtgcggcaactgcgccaggccggc
tgtgccggcttggtcgtccccgacctgcccctggaagaggccggatccctgcgggaagca
acgcaggcggaggggatcgacctcatcctgctggtggcccccaccagccccgccgagcga
atgcgccgtattgcccaacagtccagcggctttatctacctggtcagcaccaccggcgtc
accggcgaacgggccaccctggagcagcggatcccggccttgctgcagcaactgcgccaa
tacacctccctgccgattggggtaggcttcggcatctccacccccgaccaggcccgccag
attgctctctggggagcggatgcggcgatcgtgggcagtgcctttgtgcaacggctggcc
aaggcccccacccccgcccaagggctgcaacaaattgcccacttctgccgggatctcaaa
gctgccctgcaaggcataggtaccccgcaacattga

DBGET integrated database retrieval system