KEGG   Synechococcus sp. JA-3-3Ab: CYA_0285Help
Entry
CYA_0285          CDS       T00318                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CYA_0285 (ispE)
Enzymes [BR:cya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CYA_0285 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
292938..293867
Genome map
AA seq 309 aa AA seqDB search
MQACTLIARAKINLYLEILGSRPDGYSEVAMILQSITLADRVHLQRRPHGILLICDHPEV
PADARNLAYRAAELLQRECRAELGVEIQLEKQIPVAAGLAGGSADAAAVLVGLNQLWGLG
LTVGELQSLAARLGSDIPFCVQGGTQLATGRGEVLQPLADWEGIPLLLAKPRHLGVSTAW
AYQAFRAHRAASLPSAGASLPTLPQVLAALERRDLLALARSLRNDLEQPVLAEHAIVGKL
RQALLEAGALGSLMSGSGPTVFGIMASLERAAQARDSLCHHFPEVDFWVTQFAPTGILLE
PDPQALRLP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctgtaccctgattgcccgcgccaagatcaatctctacctagaaatcctcggc
tcccgccccgatggctattccgaggtggccatgatcctacagagcatcactttggcggat
cgcgtgcatctccagcgccgtccccacgggatcctcttgatttgcgatcacccggaagtg
ccggcagatgcccgcaacctggcctaccgcgcggctgagctgctgcaaagggaatgtcgg
gctgagctgggagtggagatccagctggaaaaacagatcccagtagcagcgggcttggcg
ggcggctcagcggatgcggcggcagttttggtgggtctgaaccagctttggggcctgggc
ctgacggtaggagaactgcagagcttggcggcccgtttgggatccgatattcccttttgt
gtgcagggggggacgcagttggctacgggacggggagaagttttacagccgctggccgac
tgggaagggatcccgctgctgttggccaagccccggcatctaggggtttccaccgcctgg
gcctatcaggcctttcgcgctcaccgtgccgcttccttgccttctgctggagcctctctg
ccgaccttgccccaagtcctcgctgctctggagcgtcgggatctgctggccttggcccgc
agtttgcgcaacgacctggagcagccagttttggccgagcacgctatcgtgggaaaattg
cgccaggccttgctcgaggcaggagcgctgggatccctgatgtcgggctcagggccgacg
gtgtttgggatcatggccagcctggagagggccgcccaagcccgtgacagtctgtgccac
cactttccagaggtggatttctgggtaacccagtttgctcccaccggtattctgctggag
ccggatccccaggccctccgtctcccctag

DBGET integrated database retrieval system