KEGG   Synechococcus sp. JA-3-3Ab: CYA_0285Help
Entry
CYA_0285          CDS       T00318                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cya00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
292938..293867
Genome map
AA seq 309 aa AA seqDB search
MQACTLIARAKINLYLEILGSRPDGYSEVAMILQSITLADRVHLQRRPHGILLICDHPEV
PADARNLAYRAAELLQRECRAELGVEIQLEKQIPVAAGLAGGSADAAAVLVGLNQLWGLG
LTVGELQSLAARLGSDIPFCVQGGTQLATGRGEVLQPLADWEGIPLLLAKPRHLGVSTAW
AYQAFRAHRAASLPSAGASLPTLPQVLAALERRDLLALARSLRNDLEQPVLAEHAIVGKL
RQALLEAGALGSLMSGSGPTVFGIMASLERAAQARDSLCHHFPEVDFWVTQFAPTGILLE
PDPQALRLP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctgtaccctgattgcccgcgccaagatcaatctctacctagaaatcctcggc
tcccgccccgatggctattccgaggtggccatgatcctacagagcatcactttggcggat
cgcgtgcatctccagcgccgtccccacgggatcctcttgatttgcgatcacccggaagtg
ccggcagatgcccgcaacctggcctaccgcgcggctgagctgctgcaaagggaatgtcgg
gctgagctgggagtggagatccagctggaaaaacagatcccagtagcagcgggcttggcg
ggcggctcagcggatgcggcggcagttttggtgggtctgaaccagctttggggcctgggc
ctgacggtaggagaactgcagagcttggcggcccgtttgggatccgatattcccttttgt
gtgcagggggggacgcagttggctacgggacggggagaagttttacagccgctggccgac
tgggaagggatcccgctgctgttggccaagccccggcatctaggggtttccaccgcctgg
gcctatcaggcctttcgcgctcaccgtgccgcttccttgccttctgctggagcctctctg
ccgaccttgccccaagtcctcgctgctctggagcgtcgggatctgctggccttggcccgc
agtttgcgcaacgacctggagcagccagttttggccgagcacgctatcgtgggaaaattg
cgccaggccttgctcgaggcaggagcgctgggatccctgatgtcgggctcagggccgacg
gtgtttgggatcatggccagcctggagagggccgcccaagcccgtgacagtctgtgccac
cactttccagaggtggatttctgggtaacccagtttgctcccaccggtattctgctggag
ccggatccccaggccctccgtctcccctag

DBGET integrated database retrieval system